DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCT6 and VKORC1L1

DIOPT Version :9

Sequence 1:NP_573066.1 Gene:CCT6 / 32518 FlyBaseID:FBgn0027329 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001271271.1 Gene:VKORC1L1 / 154807 HGNCID:21492 Length:177 Species:Homo sapiens


Alignment Length:116 Identity:29/116 - (25%)
Similarity:37/116 - (31%) Gaps:45/116 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 HPALADLLTDVCVNAVLTIASADKTK------------------PV-DLHMV------------- 193
            |.||.||...|..:|.|  ||...:|                  || .||.|             
Human    46 HRALCDLGPWVKCSAAL--ASRHDSKRCGGFDPHDVLHHVGRGVPVPGLHSVLCAEGVLHHLHRH 108

  Fly   194 ---ELMEMQHKSDTDTQLVRGLVMDHGAR--------HPDMPKRLENAYIL 233
               ||....::..|.:.|.|||......:        ||:..|.|...:||
Human   109 VRAELPSSHYQLQTTSLLERGLEAAAATQAGLTPDRLHPNSLKPLSIQFIL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCT6NP_573066.1 chap_CCT_zeta 3..532 CDD:274088 29/116 (25%)
TCP1_zeta 7..528 CDD:239458 29/116 (25%)
VKORC1L1NP_001271271.1 VKOR 18..>65 CDD:321633 9/20 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.