DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8944 and STP4

DIOPT Version :9

Sequence 1:	NP_573065.1	Gene:	CG8944 / 32517	FlyBaseID:	FBgn0030680	Length:	762	Species:	Drosophila melanogaster
Sequence 2:	NP_010235.1	Gene:	STP4 / 851512	SGDID:	S000002206	Length:	490	Species:	Saccharomyces cerevisiae

Alignment Length:	57	Identity:	18/57 - (31%)
Similarity:	29/57 - (50%)	Gaps:	5/57 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   636 CDVCRRSFATPGHLNAHRIVHQDERERCYKCDYPQCNKSFVARNSLFEHLKQHYSNE 692
            |.:|...:|   :|:.|:..|....:|.:||  |.|.:.|...|.|..|.|:|:.:|
Yeast   279 CPICHNFYA---NLSTHKSTHLTPEDRPHKC--PICQRGFARNNDLIRHKKRHWKDE 330

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8944	NP_573065.1	MADF_DNA_bdg	259..344	CDD:287510
		MADF	379..472	CDD:214738
		C2H2 Zn finger	476..496	CDD:275368
		C2H2 Zn finger	506..526	CDD:275368
		C2H2 Zn finger	537..557	CDD:275368
		C2H2 Zn finger	636..656	CDD:275368	5/19 (26%)
		zf-C2H2_8	639..712	CDD:292531	17/54 (31%)
		C2H2 Zn finger	666..688	CDD:275368	8/21 (38%)
		zf-C2H2	694..716	CDD:278523
		C2H2 Zn finger	696..716	CDD:275368
		zf-H2C2_2	708..733	CDD:290200
		C2H2 Zn finger	724..744	CDD:275368
STP4	NP_010235.1	COG5048	14..442	CDD:227381	18/57 (32%)
		C2H2 Zn finger	279..296	CDD:275368	5/19 (26%)
		C2H2 Zn finger	306..326	CDD:275368	8/21 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24390
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100