DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8944 and Zfp410

DIOPT Version :9

Sequence 1:NP_573065.1 Gene:CG8944 / 32517 FlyBaseID:FBgn0030680 Length:762 Species:Drosophila melanogaster
Sequence 2:NP_659082.1 Gene:Zfp410 / 52708 MGIID:1289280 Length:478 Species:Mus musculus


Alignment Length:174 Identity:49/174 - (28%)
Similarity:70/174 - (40%) Gaps:37/174 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   615 IGGGGGGGSGGGGTDIA-KPYGCDV--CRRSFATPGHLNAHRIVHQDERERCYKCDYPQCNKSFV 676
            :|.|.|.....|....| |...|.|  |.|:|..|.|...|...|::||.  :.|....|.|||.
Mouse   199 LGSGDGQPKDSGPLPQAEKKLKCTVEGCDRTFVWPAHFKYHLKTHRNERS--FICPAEGCGKSFY 261

  Fly   677 ARNSLFEHLKQHYSNEEFKC--DICGKTFKSTKNLQNHKQIHDKIKRYV---------------- 723
            ....|..|::.|...:.|.|  ..|||.|.:..||:||::||...|.::                
Mouse   262 VLQRLKVHMRTHNGEKPFMCHESGCGKQFTTAGNLKNHRRIHTGEKPFLCEAQGCGRSFAEYSSL 326

  Fly   724 --------------CQICGSAFAQAAGLYLHKRRHNRPNGAVGA 753
                          ||:||..|:|:....:|.|:|:...|..|:
Mouse   327 RKHLVVHSGEKPHQCQVCGKTFSQSGSRNVHMRKHHLQLGTTGS 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8944NP_573065.1 MADF_DNA_bdg 259..344 CDD:287510
MADF 379..472 CDD:214738
C2H2 Zn finger 476..496 CDD:275368
C2H2 Zn finger 506..526 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 636..656 CDD:275368 8/21 (38%)
zf-C2H2_8 639..712 CDD:292531 25/74 (34%)
C2H2 Zn finger 666..688 CDD:275368 7/21 (33%)
zf-C2H2 694..716 CDD:278523 10/23 (43%)
C2H2 Zn finger 696..716 CDD:275368 9/21 (43%)
zf-H2C2_2 708..733 CDD:290200 12/54 (22%)
C2H2 Zn finger 724..744 CDD:275368 8/19 (42%)
Zfp410NP_659082.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..113
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..214 4/14 (29%)
SFP1 <189..300 CDD:227516 34/102 (33%)
C2H2 Zn finger 221..243 CDD:275368 8/21 (38%)
C2H2 Zn finger 251..273 CDD:275368 7/21 (33%)
zf-H2C2_2 265..292 CDD:372612 9/26 (35%)
C2H2 Zn finger 281..303 CDD:275368 9/21 (43%)
zf-H2C2_2 295..321 CDD:372612 7/25 (28%)
C2H2 Zn finger 311..333 CDD:275368 0/21 (0%)
zf-H2C2_2 325..350 CDD:372612 5/24 (21%)
C2H2 Zn finger 341..361 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.