Sequence 1: | NP_573065.1 | Gene: | CG8944 / 32517 | FlyBaseID: | FBgn0030680 | Length: | 762 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_524581.1 | Gene: | Sry-delta / 43572 | FlyBaseID: | FBgn0003512 | Length: | 433 | Species: | Drosophila melanogaster |
Alignment Length: | 297 | Identity: | 59/297 - (19%) |
---|---|---|---|
Similarity: | 94/297 - (31%) | Gaps: | 112/297 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 475 KCAHCPEIVQTLRELDLHMLTHQPSLGGGYYCNICSIQFHNAQEFDNHKQLHLGGVTEIKFNCEL 539
Fly 540 CTASFREKANYDEHLRRHNEE-----------LFLPSLALNHSIMEGGLGDDEIGVEGEESRGSG 593
Fly 594 SRRKRRHAAKATDDMVDDDDRIGGGGGGGSGGGGTDIAKPYGCDVCRRSFATPGHLNAHRIVHQD 658
Fly 659 ERERCYKCDYPQCNKSFVARNSLFEHLKQH----------------------------------- 688
Fly 689 ---YSNEEFK--CDICGKTFKSTKNLQNHKQI-HDKI 719 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8944 | NP_573065.1 | MADF_DNA_bdg | 259..344 | CDD:287510 | |
MADF | 379..472 | CDD:214738 | |||
C2H2 Zn finger | 476..496 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 506..526 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 537..557 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 636..656 | CDD:275368 | 6/19 (32%) | ||
zf-C2H2_8 | 639..712 | CDD:292531 | 27/112 (24%) | ||
C2H2 Zn finger | 666..688 | CDD:275368 | 9/21 (43%) | ||
zf-C2H2 | 694..716 | CDD:278523 | 8/24 (33%) | ||
C2H2 Zn finger | 696..716 | CDD:275368 | 8/20 (40%) | ||
zf-H2C2_2 | 708..733 | CDD:290200 | 5/13 (38%) | ||
C2H2 Zn finger | 724..744 | CDD:275368 | |||
Sry-delta | NP_524581.1 | COG5048 | <205..360 | CDD:227381 | 44/214 (21%) |
C2H2 Zn finger | 225..245 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 253..273 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 281..301 | CDD:275368 | 3/45 (7%) | ||
C2H2 Zn finger | 310..327 | CDD:275370 | 5/16 (31%) | ||
zf-C2H2 | 337..359 | CDD:278523 | 10/24 (42%) | ||
C2H2 Zn finger | 339..359 | CDD:275368 | 9/21 (43%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45455465 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |