DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8944 and Sry-delta

DIOPT Version :9

Sequence 1:NP_573065.1 Gene:CG8944 / 32517 FlyBaseID:FBgn0030680 Length:762 Species:Drosophila melanogaster
Sequence 2:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster


Alignment Length:297 Identity:59/297 - (19%)
Similarity:94/297 - (31%) Gaps:112/297 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   475 KCAHCPEIVQTLRELDLHMLTHQPSLGGGYYCNICSIQFHNAQEFDNHKQLHLGGVTEIKFNCEL 539
            :|..|.::..:..:|..| ::.:.|....:.|.||.:...:.:..:.|..||.|   :.:..|..
  Fly   195 ECTTCGKVYNSWYQLQKH-ISEEHSKQPNHICPICGVIRRDEEYLELHMNLHEG---KTEKQCRY 255

  Fly   540 CTASFREKANYDEHLRRHNEE-----------LFLPSLALNHSIMEGGLGDDEIGVEGEESRGSG 593
            |..||....|...|:|.|.::           ....:|..||.:                     
  Fly   256 CPKSFSRPVNTLRHMRMHWDKKKYQCEKCGLRFSQDNLLYNHRL--------------------- 299

  Fly   594 SRRKRRHAAKATDDMVDDDDRIGGGGGGGSGGGGTDIAKPYGCDVCRRSFATPGHLNAHRIVHQD 658
                 ||.|:                           ..|..|.:|..||.:....|.|.::|::
  Fly   300 -----RHEAE---------------------------ENPIICSICNVSFKSRKTFNHHTLIHKE 332

  Fly   659 ERERCYKCDYPQCNKSFVARNSLFEHLKQH----------------------------------- 688
            .|.|.| |..  |.|||..|.:|..|:|.|                                   
  Fly   333 NRPRHY-CSV--CPKSFTERYTLKMHMKTHEGDVVYGVREEAPADEQQVVEELHVDVDESEAAVT 394

  Fly   689 ---YSNEEFK--CDICGKTFKSTKNLQNHKQI-HDKI 719
               ..|:|..  |.||...|::.|.|::|.|. ||.:
  Fly   395 VIMSDNDENSGFCLICNTNFENKKELEHHLQFDHDVV 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8944NP_573065.1 MADF_DNA_bdg 259..344 CDD:287510
MADF 379..472 CDD:214738
C2H2 Zn finger 476..496 CDD:275368 4/19 (21%)
C2H2 Zn finger 506..526 CDD:275368 4/19 (21%)
C2H2 Zn finger 537..557 CDD:275368 7/19 (37%)
C2H2 Zn finger 636..656 CDD:275368 6/19 (32%)
zf-C2H2_8 639..712 CDD:292531 27/112 (24%)
C2H2 Zn finger 666..688 CDD:275368 9/21 (43%)
zf-C2H2 694..716 CDD:278523 8/24 (33%)
C2H2 Zn finger 696..716 CDD:275368 8/20 (40%)
zf-H2C2_2 708..733 CDD:290200 5/13 (38%)
C2H2 Zn finger 724..744 CDD:275368
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 44/214 (21%)
C2H2 Zn finger 225..245 CDD:275368 4/19 (21%)
C2H2 Zn finger 253..273 CDD:275368 7/19 (37%)
C2H2 Zn finger 281..301 CDD:275368 3/45 (7%)
C2H2 Zn finger 310..327 CDD:275370 5/16 (31%)
zf-C2H2 337..359 CDD:278523 10/24 (42%)
C2H2 Zn finger 339..359 CDD:275368 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455465
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.