DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8944 and CG8319

DIOPT Version :9

Sequence 1:NP_573065.1 Gene:CG8944 / 32517 FlyBaseID:FBgn0030680 Length:762 Species:Drosophila melanogaster
Sequence 2:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster


Alignment Length:417 Identity:88/417 - (21%)
Similarity:133/417 - (31%) Gaps:144/417 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 AKLLSMVKRYQCFYNRFDPD------------------YRSKERRGEGLHQ--MAIELQQLI--- 419
            |||..|||  .|...:.|||                  |..|.|..|...:  :||...|:|   
  Fly    30 AKLAEMVK--TCADVQLDPDDAMPQKMCISCVHDARTAYGFKRRCEENYKKFYLAILNGQVIKDE 92

  Fly   420 ----DVTTIQ------------ISKRISQLRFDYSKQKMERLNSERLGKKF--IANYLYYDQMHF 466
                |...|:            ::|.|.:.....|:.....:.:.|.|::.  |.|         
  Fly    93 PNEEDFLFIENPDKGNLEAKKKLNKEIKKTHQTASRTTKSSITTSRAGRQLRSIKN--------- 148

  Fly   467 MDDDIPPFKCAHCPEIVQTLRELDL--HMLTHQPSLGGGYYCNICSIQFHNAQEFDNHKQLHLGG 529
                 ..|||..|  |.|..|:::|  ||..|..|    :.|..|..:|....:.|||:......
  Fly   149 -----QTFKCELC--IKQFKRQINLLDHMKVHSNS----HVCQNCEERFLFKADLDNHQCYRNSN 202

  Fly   530 VTEIKFNCELCTASFREKANYDEHLRRHNEELFLPSLALNHSIMEGGLGDDEIGVEGEESRGSGS 594
            .|   ..|..|...|....:.|.|..:..:|                                  
  Fly   203 ST---VECPECLKVFSSTQSLDSHKCKDMQE---------------------------------- 230

  Fly   595 RRKRRHAAKATDDMVDDDDRIGGGGGGGSGGGGTDIAKPYGCDVCRRSFATPGHLNAHRIVHQDE 659
                                                ..|:.|..|:::|....:|.||.::|.:.
  Fly   231 ------------------------------------RSPFQCPHCQQAFTREQNLKAHLLIHAES 259

  Fly   660 RE--RCYKCDYPQCNKSFVARNSLFEHLKQHYSNEEFKCDICGKTFKSTKNLQNHKQIHDKIKRY 722
            ::  ..:||.|  |...|..:::|..|:..|.......|..|...|:|.:.|:.|.:||...|.|
  Fly   260 KQGNGPHKCSY--CQTGFFNKSALKVHIHAHMGERPHACPFCVSNFRSKQALKVHIRIHTGEKPY 322

  Fly   723 VCQICGSAFAQAAGLYLHKRRHN--RP 747
            .|..|...|:....|..|:|||:  ||
  Fly   323 QCPHCPKTFSDNNNLAKHRRRHSDERP 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8944NP_573065.1 MADF_DNA_bdg 259..344 CDD:287510
MADF 379..472 CDD:214738 26/133 (20%)
C2H2 Zn finger 476..496 CDD:275368 8/21 (38%)
C2H2 Zn finger 506..526 CDD:275368 6/19 (32%)
C2H2 Zn finger 537..557 CDD:275368 5/19 (26%)
C2H2 Zn finger 636..656 CDD:275368 6/19 (32%)
zf-C2H2_8 639..712 CDD:292531 19/74 (26%)
C2H2 Zn finger 666..688 CDD:275368 6/21 (29%)
zf-C2H2 694..716 CDD:278523 6/21 (29%)
C2H2 Zn finger 696..716 CDD:275368 6/19 (32%)
zf-H2C2_2 708..733 CDD:290200 9/24 (38%)
C2H2 Zn finger 724..744 CDD:275368 6/19 (32%)
CG8319NP_649920.2 zf-AD 4..79 CDD:285071 14/50 (28%)
COG5048 <153..368 CDD:227381 59/278 (21%)
C2H2 Zn finger 153..173 CDD:275368 8/21 (38%)
C2H2 Zn finger 179..196 CDD:275368 5/16 (31%)
C2H2 Zn finger 207..227 CDD:275370 5/19 (26%)
C2H2 Zn finger 236..256 CDD:275368 6/19 (32%)
C2H2 Zn finger 268..288 CDD:275368 6/21 (29%)
C2H2 Zn finger 296..316 CDD:275368 6/19 (32%)
zf-H2C2_2 308..332 CDD:290200 8/23 (35%)
zf-C2H2 322..344 CDD:278523 7/21 (33%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..368 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.