Sequence 1: | NP_573065.1 | Gene: | CG8944 / 32517 | FlyBaseID: | FBgn0030680 | Length: | 762 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_649494.1 | Gene: | CG14655 / 40594 | FlyBaseID: | FBgn0037275 | Length: | 525 | Species: | Drosophila melanogaster |
Alignment Length: | 375 | Identity: | 84/375 - (22%) |
---|---|---|---|
Similarity: | 124/375 - (33%) | Gaps: | 138/375 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 473 PFKC--AHCPEIVQTLRELDLHMLTH---------------QPSLGGGY---------------- 504
Fly 505 ---------------YCNICSIQFHNAQEFDNHKQL-HLGGVTEIK-------------FNCELC 540
Fly 541 TASFREKANYDEHLR-----------------------------------------RHNEELFLP 564
Fly 565 SLALNHSIMEGGLGDDEIGVEGEESRGSGSRRKRRHAAKATDDMVDDDDRIGGGGGGGSGGGGTD 629
Fly 630 IAKPYGCDVCRRSFATPGHLNAHRIVHQDERERCYKCDYPQCNKSFVARNSLFEHLKQHYSNEEF 694
Fly 695 KCDICGKTFKSTKNLQNHKQIHDKIKRYVCQICGSAFAQAAGLYLHKRRH 744 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8944 | NP_573065.1 | MADF_DNA_bdg | 259..344 | CDD:287510 | |
MADF | 379..472 | CDD:214738 | |||
C2H2 Zn finger | 476..496 | CDD:275368 | 7/21 (33%) | ||
C2H2 Zn finger | 506..526 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 537..557 | CDD:275368 | 8/60 (13%) | ||
C2H2 Zn finger | 636..656 | CDD:275368 | 9/19 (47%) | ||
zf-C2H2_8 | 639..712 | CDD:292531 | 22/72 (31%) | ||
C2H2 Zn finger | 666..688 | CDD:275368 | 6/21 (29%) | ||
zf-C2H2 | 694..716 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 696..716 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 708..733 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 724..744 | CDD:275368 | 7/19 (37%) | ||
CG14655 | NP_649494.1 | C2H2 Zn finger | 268..288 | CDD:275368 | 9/19 (47%) |
zf-H2C2_2 | 281..304 | CDD:290200 | 7/26 (27%) | ||
C2H2 Zn finger | 324..344 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 339..361 | CDD:290200 | 9/21 (43%) | ||
C2H2 Zn finger | 352..372 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 364..389 | CDD:290200 | 3/9 (33%) | ||
C2H2 Zn finger | 380..396 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24390 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |