Sequence 1: | NP_573065.1 | Gene: | CG8944 / 32517 | FlyBaseID: | FBgn0030680 | Length: | 762 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
Alignment Length: | 327 | Identity: | 75/327 - (22%) |
---|---|---|---|
Similarity: | 111/327 - (33%) | Gaps: | 99/327 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 480 PEIVQTLRELDLHMLTHQPSLGGGYYCNICSIQFHNAQEFDNHKQLHLGGVTEIKFNCELCTASF 544
Fly 545 ----------REKANYDEHLRRHNEELFLPSLALN----------HSIMEGG------------- 576
Fly 577 ----------------LGDD---EIGVEGEESRGSGSRRKRRHAAKATDDM--------VDDDDR 614
Fly 615 IGGGGGGGSGGGGTDIAKPYGCDVCRRSFATPGHLNAHRIVHQDERERCYKCDYPQCNKSFVARN 679
Fly 680 SLFEHLKQHYSNEEFKCDICGKTFKSTKNLQNHKQIHDKIKRYVCQICGSAFAQAAGLYLHKRRH 744
Fly 745 NR 746 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8944 | NP_573065.1 | MADF_DNA_bdg | 259..344 | CDD:287510 | |
MADF | 379..472 | CDD:214738 | |||
C2H2 Zn finger | 476..496 | CDD:275368 | 4/15 (27%) | ||
C2H2 Zn finger | 506..526 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 537..557 | CDD:275368 | 7/29 (24%) | ||
C2H2 Zn finger | 636..656 | CDD:275368 | 6/19 (32%) | ||
zf-C2H2_8 | 639..712 | CDD:292531 | 24/72 (33%) | ||
C2H2 Zn finger | 666..688 | CDD:275368 | 6/21 (29%) | ||
zf-C2H2 | 694..716 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 696..716 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 708..733 | CDD:290200 | 7/24 (29%) | ||
C2H2 Zn finger | 724..744 | CDD:275368 | 7/19 (37%) | ||
CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | 16/83 (19%) |
zf-C2H2 | 215..237 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 229..254 | CDD:290200 | 11/28 (39%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 6/21 (29%) | ||
zf-H2C2_2 | 257..282 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 286..310 | CDD:290200 | 7/23 (30%) | ||
C2H2 Zn finger | 301..321 | CDD:275368 | 7/19 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24390 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |