DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8944 and CG10654

DIOPT Version :9

Sequence 1:NP_573065.1 Gene:CG8944 / 32517 FlyBaseID:FBgn0030680 Length:762 Species:Drosophila melanogaster
Sequence 2:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster


Alignment Length:323 Identity:70/323 - (21%)
Similarity:119/323 - (36%) Gaps:92/323 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   470 DIPP---FK--CAHCPEIVQTLREL---------DLHMLTHQPSLGGGYYCNICSIQFHNAQEFD 520
            |:||   .|  |..|.::||...:.         :...|.....:|    |:  .::.|...:.|
  Fly    77 DLPPQLVLKSICECCYQLVQKFHDFQRMCAESLRNFEKL
LQDIDIG----CH--KLEDHTWHDLD 135

  Fly   521 NHKQLHLGGVTEIKFNCELCTASFREKANYDEHLRRHNEELFLPSLALNHSIMEGGLGDDEIGVE 585
            ...:.:.....|.:.:.. |.|:.:|..::..      .::.||...:...|..|...::|:.|.
  Fly   136 TPSESNESTNPEAQSHAP-CIAATQEIVSFIW------PQVCLPLAVILSRITLGASLEEEVYVI 193

  Fly   586 GEESR----------------GSGSRRKRRHAAKATDDMVDDDDRIGGGGGGGSGGGGTDIAKPY 634
            .:||.                |:..||..||..:                               
  Fly   194 EDESAKQDLGQEKLSISSKLLGARKRRGVRHTLE------------------------------- 227

  Fly   635 GCDVCRRSFATPGHLNAHRIVHQDERERCYKCDYPQCNKSFVARNSLFEHLKQHYSNEE-----F 694
             |.:|.|.|..|..|.||  :.|.|..|.|.|.:  |.||:...|.|..||:|.::|.:     :
  Fly   228 -CRICHRGFYKPSLLEAH--MQQHEGLRPYTCVH--CAKSYARANLLESHLRQMHNNADAARIIY 287

  Fly   695 KCDICGKTFKSTKNLQNH-KQIHDKI-------KRYVCQICGSAFAQAAGLYLHKRRHNRPNG 749
            .|..|.|.:.:.::|:.| ::.|::.       .|::|:.||..||:.|.|..||..|....|
  Fly   288 ACPSCNKVYTANRSLKYHMRRTHERYHESESPDARHICEECGKCFARKAHLTRHKMVHGSVEG 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8944NP_573065.1 MADF_DNA_bdg 259..344 CDD:287510
MADF 379..472 CDD:214738 1/1 (100%)
C2H2 Zn finger 476..496 CDD:275368 5/28 (18%)
C2H2 Zn finger 506..526 CDD:275368 3/19 (16%)
C2H2 Zn finger 537..557 CDD:275368 3/19 (16%)
C2H2 Zn finger 636..656 CDD:275368 8/19 (42%)
zf-C2H2_8 639..712 CDD:292531 25/77 (32%)
C2H2 Zn finger 666..688 CDD:275368 8/21 (38%)
zf-C2H2 694..716 CDD:278523 5/22 (23%)
C2H2 Zn finger 696..716 CDD:275368 5/20 (25%)
zf-H2C2_2 708..733 CDD:290200 8/32 (25%)
C2H2 Zn finger 724..744 CDD:275368 9/19 (47%)
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 8/37 (22%)
C2H2 Zn finger 228..248 CDD:275368 8/21 (38%)
C2H2 Zn finger 256..313 CDD:275368 16/58 (28%)
C2H2 Zn finger 289..314 CDD:275368 6/24 (25%)
zf-C2H2 323..345 CDD:278523 9/21 (43%)
C2H2 Zn finger 325..345 CDD:275368 9/19 (47%)
C2H2 Zn finger 355..376 CDD:275368
C2H2 Zn finger 385..405 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455468
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.