DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8944 and CG2199

DIOPT Version :9

Sequence 1:NP_573065.1 Gene:CG8944 / 32517 FlyBaseID:FBgn0030680 Length:762 Species:Drosophila melanogaster
Sequence 2:NP_728599.1 Gene:CG2199 / 38159 FlyBaseID:FBgn0035213 Length:733 Species:Drosophila melanogaster


Alignment Length:283 Identity:53/283 - (18%)
Similarity:91/283 - (32%) Gaps:67/283 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   504 YYCNICSIQFHNAQEFDNHKQLHLGGVTEIKFNCELCTASFREKANYDEHLRRHNEELF---LPS 565
            :.|..|.......:.:..|.|...|......:.|.||..:|........|||..:...|   ..:
  Fly   228 FQCPECEFHAKFPKPYKEHLQKEHGLQRPRIYPCTLCIKTFGVLKTLKNHLRDTHSRTFESEAKT 292

  Fly   566 LALNHSIMEGGLG-DDEIGVEGEESRGSGSRRK---RRHAAKATD-------DMVDD-DDRIGGG 618
            .|......|...| .::|..:.:|:.....|:|   ::...|.|:       .:||: ||::...
  Fly   293 KAKESKEKEAKSGAKNKIDAKAKETNAVSQRKKPKEKKSKEKKTEIKCNVETKVVDEIDDQVNNK 357

  Fly   619 GGGGSGGGGTDIAKPYGCDVCRRSFATPGHLNAHRIVHQDERERCYKCDYPQCNKSFVARNSLFE 683
            .|..|...                               |:.:......:...|:|.:.:..|..
  Fly   358 KGTDSEDA-------------------------------DQTQATKIASFKALNESLMKKRMLEN 391

  Fly   684 HLKQHYS--------------NEEFKCDICGKTFKSTKNLQNH-KQIH--DKIKRYVCQICGSAF 731
            .:...|:              :..|:|:||.....:.|.:|.| |.:|  ||.|.:.|.:|..:.
  Fly   392 VIDSEYTFAINGSSASTPRADSNNFQCEICDCELMTAKQMQEHMKTVHSIDKPKVFKCHVCEKSL 456

  Fly   732 AQAAGLYLHKRRH----NRPNGA 750
            |....|..|...|    ..||.:
  Fly   457 ATKQSLKTHMTLHADGAEAPNSS 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8944NP_573065.1 MADF_DNA_bdg 259..344 CDD:287510
MADF 379..472 CDD:214738
C2H2 Zn finger 476..496 CDD:275368
C2H2 Zn finger 506..526 CDD:275368 4/19 (21%)
C2H2 Zn finger 537..557 CDD:275368 7/19 (37%)
C2H2 Zn finger 636..656 CDD:275368 0/19 (0%)
zf-C2H2_8 639..712 CDD:292531 11/86 (13%)
C2H2 Zn finger 666..688 CDD:275368 3/21 (14%)
zf-C2H2 694..716 CDD:278523 8/22 (36%)
C2H2 Zn finger 696..716 CDD:275368 7/20 (35%)
zf-H2C2_2 708..733 CDD:290200 9/27 (33%)
C2H2 Zn finger 724..744 CDD:275368 5/19 (26%)
CG2199NP_728599.1 C2H2 Zn finger 418..439 CDD:275370 7/20 (35%)
C2H2 Zn finger 449..469 CDD:275370 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440030
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.