DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8944 and CG10631

DIOPT Version :9

Sequence 1:NP_573065.1 Gene:CG8944 / 32517 FlyBaseID:FBgn0030680 Length:762 Species:Drosophila melanogaster
Sequence 2:NP_609998.1 Gene:CG10631 / 35262 FlyBaseID:FBgn0032817 Length:3781 Species:Drosophila melanogaster


Alignment Length:390 Identity:81/390 - (20%)
Similarity:129/390 - (33%) Gaps:99/390 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 PDYRSKERRGEGLHQMAIELQQLIDVTTIQISKRISQLRFDYSKQKM---ERLNSER--LGKKFI 455
            |:|      |.|.:.:|....||:.....|..::..|.:.....|..   :.::.:|  :|...:
  Fly   126 PNY------GLGANTVAYAHNQLLQYQQQQQQQQQQQQQQQQQHQHQHLPQHISQQRPYMGHNIM 184

  Fly   456 AN---YLYYDQMHFMDDDIPPFKCAHCPEIVQTLRELDLHMLTHQPSLGGGYYCNIC--SIQFHN 515
            ..   |:..:.|........|......||::.....:|.|          .|..|..  :..|.:
  Fly   185 TGSYPYIKSEPMEAYQQPPNPMAPPPAPEVLIKSEPIDEH----------SYKSNYIDDNTPFAD 239

  Fly   516 AQEFDNHKQLHLGGVTEIKFNCE---LCTASF-REKANYD---EHL---RRHNEELFLPSLALNH 570
            ..:|....:..|....|:....|   ..|:|| |.|...|   |.|   :|..|..|...:.|.|
  Fly   240 FSKFSEFSEDMLSPKVELTVKDESYGRTTSSFLRRKQQSDRGNESLPICQRCKEVFFKKQVYLRH 304

  Fly   571 SIMEGGLGDDEIGVEGEESRGSGSRRKRRHAAKATDDMVDDDDRIGGGGGGGSGGGGTDIAKPYG 635
             :.|...|..|.                                                  .:.
  Fly   305 -VAESNCGIQEY--------------------------------------------------DFK 318

  Fly   636 CDVCRRSFATPGHLNAHRIVHQDERERCYKCDYPQCNKSF--VARNSLFEHLKQHYSNEEFKCDI 698
            |..|..||.|...|..|::.|:.:|..|:|    .|.|.|  :|.....|:::..|  :.|.|::
  Fly   319 CSTCPMSFMTTEELQRHKLHHRADRFFCHK----YCGKHFDTIAECEAHEYMQHEY--DSFVCNM 377

  Fly   699 CGKTFKSTKNLQNHKQIHDKIKRYVCQICGSAFAQAAGLYLHKRRHNRPN--GAVGAVGRSGRSS 761
            |..||.:.:.|..|...|...:|:.|.||...:..|  |.||:.|...|.  |.....|:|..:|
  Fly   378 CSGTFATREQLYAHLPQHKFQQRFDCPICRLWYQTA--LELHEHRLAAPYFCGKYYTGGQSSSAS 440

  Fly   762  761
              Fly   441  440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8944NP_573065.1 MADF_DNA_bdg 259..344 CDD:287510
MADF 379..472 CDD:214738 14/83 (17%)
C2H2 Zn finger 476..496 CDD:275368 4/19 (21%)
C2H2 Zn finger 506..526 CDD:275368 3/21 (14%)
C2H2 Zn finger 537..557 CDD:275368 9/29 (31%)
C2H2 Zn finger 636..656 CDD:275368 7/19 (37%)
zf-C2H2_8 639..712 CDD:292531 22/74 (30%)
C2H2 Zn finger 666..688 CDD:275368 5/23 (22%)
zf-C2H2 694..716 CDD:278523 7/21 (33%)
C2H2 Zn finger 696..716 CDD:275368 6/19 (32%)
zf-H2C2_2 708..733 CDD:290200 7/24 (29%)
C2H2 Zn finger 724..744 CDD:275368 7/19 (37%)
CG10631NP_609998.1 C2H2 Zn finger 288..311 CDD:275368 6/23 (26%)
C2H2 Zn finger 319..339 CDD:275368 7/19 (37%)
DM3 584..642 CDD:128933
DM3 683..738 CDD:128933
DM3 775..832 CDD:128933
DM3 945..1000 CDD:128933
DM3 1038..1096 CDD:128933
DM3 1145..1198 CDD:128933
THAP 1236..1308 CDD:214951
DM3 1349..1406 CDD:128933
THAP 1424..1493 CDD:214951
DM3 1538..1596 CDD:128933
DM3 1683..1739 CDD:128933
DM3 1778..1831 CDD:128933
DM3 1980..2033 CDD:128933
DM3 2147..2202 CDD:128933
DM3 2308..2365 CDD:128933
DM3 2434..2491 CDD:128933
DM3 2539..2598 CDD:128933
DM3 2622..2680 CDD:128933
DM3 2718..2775 CDD:128933
DM3 2907..2965 CDD:128933
DM3 3098..3155 CDD:128933
DM3 3227..3284 CDD:128933
DM3 3396..3452 CDD:128933
DM3 3544..3601 CDD:128933
THAP 3621..>3669 CDD:283206
DM3 3690..3748 CDD:128933
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.