DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8944 and CG11696

DIOPT Version :9

Sequence 1:NP_573065.1 Gene:CG8944 / 32517 FlyBaseID:FBgn0030680 Length:762 Species:Drosophila melanogaster
Sequence 2:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster


Alignment Length:742 Identity:152/742 - (20%)
Similarity:244/742 - (32%) Gaps:293/742 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 DLPNFHEIEDLTDADTAL--------LEPQMVIK-QELQD-LPCSD--DDVVAGEEDDDEQRLN- 139
            :||   |:.:||:.:.||        :||::..: .:::| :.|..  |.:.||:|.|.:.... 
  Fly    87 ELP---ELPELTEPEPALVVWNTESPIEPKLSYEGDDIKDHILCEPVIDALSAGDEKDSDYGDTF 148

  Fly   140 ------DSEADEDEAILPESDVP----------------VVSSKTRARK-----KVT-------K 170
                  :|:.||:|...|:...|                ::..|...||     |:|       :
  Fly   149 EPDFEPESQPDEEEEPEPDPVKPRPRGRPRKTALQQTHQIIKRKYEKRKQQNKAKITELSLRESR 213

  Fly   171 QRQRDMSSELLIAGDGDSSMDDYGDPDHSYMDDNSGEYMDFAGFDGVNHSGFGTESDFLSYDEMV 235
            .|||::......|.|     |..||.|....:|..||                            
  Fly   214 ARQRELKRSSAGAED-----DQDGDEDEEDEEDVGGE---------------------------- 245

  Fly   236 EESLLGRDREVTMHIKDRKMIQFLIHSYQRNPFLWDHGNAQFRDRVKRARFLDWIVLEFKSRFNI 300
                                             |....:.|.:.|.||.|               
  Fly   246 ---------------------------------LTPDADEQPKPRGKRGR--------------- 262

  Fly   301 SLAKDAITRKWDNLRTVYKRECNRMALEKTNISTLWYFKELHFLNEVYSYNDKMSDAVVKE---- 361
            ...|..:|.. ||      .:.:.:.:::::|      ||   :::..:.|.|:..|:...    
  Fly   263 PKTKKLVTAD-DN------DDTSEVPVKRSSI------KE---MDDYIAANVKLDCAICAAPLED 311

  Fly   362 -TSYRRRFSAIWNDTSTAKLLSMVKRYQCFYNRF--------------DPDYRSKE--------R 403
             ...:|.|....:.|...|         |..||:              ||.|.|.:        |
  Fly   312 FNDLKRHFRVEHDCTGYVK---------CCNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKNFLNR 367

  Fly   404 RGEGLHQMAIELQQLIDVTTIQISKRISQLRFDYSKQKMER---LNSERLGKKFIANYLYYDQMH 465
            ..:.:|                      .|||...:|::..   :...|..|||:..      ||
  Fly   368 NSQVMH----------------------MLRFHSQQQELVHQCAICEARFAKKFLLT------MH 404

  Fly   466 FMDDDIPPFKCAHCPEIVQTLRELDLHMLTHQPSLGGGYYCNICSIQFHNAQEFDNH-KQLHLGG 529
                                   |..|..|.:|.:     |:.||..|....|...| |::|...
  Fly   405 -----------------------LKGHKGTERPEV-----CDTCSKTFRTKFELSAHVKRMHAAD 441

  Fly   530 VTEIKFNCELCTASFREKANYDEHLRRHNEELFLPSLALNHSIMEGGLGDDEIGVEGEESRGSGS 594
            .|.|  .|::|...||.|||:..|.:           ||:   .:|.:.:.:..:.|...|...|
  Fly   442 FTPI--ICDICGTHFRSKANFLIHKK-----------ALH---PDGPVAEVQCTLCGRWLRDERS 490

  Fly   595 RRKRRHAAKATDDMVDDDDRIGGGGGGGSGGGGTDIAKPYGCDVCRRSFATPGHLNAH-RIVHQD 658
            .||  |.|:       .|||.|.              ..|.|.:|....::...|::| |..|..
  Fly   491 LRK--HLAR-------HDDRDGD--------------TKYRCLLCNAEKSSRAALSSHMRYHHSA 532

  Fly   659 ERERCYKCDYPQCNKSFVARNSLFEHLKQHYSNEEFKCDICGKTFKSTKNLQNH-KQIH--DKIK 720
            :|.:|..||     |.|....:|.||:..|...:.::|..|.:||||..|:.|| |::|  |.::
  Fly   533 KRHKCSLCD-----KEFKLPRALAEHMATHTGIDLYQCQFCTRTFKSHANMHNHKKKMHPNDWVR 592

  Fly   721 RYVCQICGSAFAQAAGLYLHKRRHNRP 747
            :| .|...|..:.||.| .|....|:|
  Fly   593 KY-SQPSSSITSTAAPL-AHPNHPNQP 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8944NP_573065.1 MADF_DNA_bdg 259..344 CDD:287510 13/84 (15%)
MADF 379..472 CDD:214738 20/117 (17%)
C2H2 Zn finger 476..496 CDD:275368 2/19 (11%)
C2H2 Zn finger 506..526 CDD:275368 7/20 (35%)
C2H2 Zn finger 537..557 CDD:275368 8/19 (42%)
C2H2 Zn finger 636..656 CDD:275368 5/20 (25%)
zf-C2H2_8 639..712 CDD:292531 22/73 (30%)
C2H2 Zn finger 666..688 CDD:275368 7/21 (33%)
zf-C2H2 694..716 CDD:278523 10/22 (45%)
C2H2 Zn finger 696..716 CDD:275368 10/20 (50%)
zf-H2C2_2 708..733 CDD:290200 9/27 (33%)
C2H2 Zn finger 724..744 CDD:275368 6/19 (32%)
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 2/16 (13%)
C2H2 Zn finger 357..378 CDD:275368 4/42 (10%)
C2H2 Zn finger 388..408 CDD:275368 7/48 (15%)
C2H2 Zn finger 417..438 CDD:275368 7/20 (35%)
C2H2 Zn finger 447..465 CDD:275368 8/17 (47%)
C2H2 Zn finger 478..498 CDD:275368 7/28 (25%)
C2H2 Zn finger 509..529 CDD:275368 5/19 (26%)
C2H2 Zn finger 537..557 CDD:275368 8/24 (33%)
C2H2 Zn finger 565..583 CDD:275368 9/17 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.