Sequence 1: | NP_573065.1 | Gene: | CG8944 / 32517 | FlyBaseID: | FBgn0030680 | Length: | 762 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_572312.1 | Gene: | CG12219 / 31572 | FlyBaseID: | FBgn0043796 | Length: | 562 | Species: | Drosophila melanogaster |
Alignment Length: | 526 | Identity: | 81/526 - (15%) |
---|---|---|---|
Similarity: | 133/526 - (25%) | Gaps: | 267/526 - (50%) |
- Green bases have known domain annotations that are detailed below.
Fly 421 VTTIQISKRISQLRFDYSKQKMERLNSERLGKKFIANYLYYD-QMHFMDD------DIPP---FK 475
Fly 476 CAHCPEIVQTLRELDLHMLTHQPSLGGGYYCNICSIQFHNAQEFDNHKQLHLGGVTEIKFNCELC 540
Fly 541 TASFREKANYDEHLRRHNEELFL------------------------------------------ 563
Fly 564 ------------------------------------------------PSLALNHSIMEGGLGDD 580
Fly 581 EIGVEGEESRGSGSRRKRR--HAAKAT-----DDMVDDDD------------------------- 613
Fly 614 -RIGGGGGG------------------------------------GSGGG--------GTDIAKP 633
Fly 634 YG------------------------CDVCRRSFATPGHLNAHRIVHQDERERCYKCDYPQCNKS 674
Fly 675 FVARNSLFEHLKQHYSNEEFKCDICGKTFKSTKNLQNHKQIHDKIKRYVCQICGSAFAQAAGLYL 739
Fly 740 H-KRRH 744 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8944 | NP_573065.1 | MADF_DNA_bdg | 259..344 | CDD:287510 | |
MADF | 379..472 | CDD:214738 | 12/57 (21%) | ||
C2H2 Zn finger | 476..496 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 506..526 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 537..557 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 636..656 | CDD:275368 | 3/19 (16%) | ||
zf-C2H2_8 | 639..712 | CDD:292531 | 14/72 (19%) | ||
C2H2 Zn finger | 666..688 | CDD:275368 | 0/21 (0%) | ||
zf-C2H2 | 694..716 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 696..716 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 708..733 | CDD:290200 | 7/24 (29%) | ||
C2H2 Zn finger | 724..744 | CDD:275368 | 7/20 (35%) | ||
CG12219 | NP_572312.1 | zf-AD | 2..94 | CDD:285071 | 7/31 (23%) |
C2H2 Zn finger | 140..160 | CDD:275368 | 4/19 (21%) | ||
COG4049 | 149..204 | CDD:226535 | 10/57 (18%) | ||
C2H2 Zn finger | 168..186 | CDD:275368 | 6/17 (35%) | ||
C2H2 Zn finger | 473..493 | CDD:275370 | 9/19 (47%) | ||
C2H2 Zn finger | 501..522 | CDD:275370 | 7/20 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45455478 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |