Sequence 1: | NP_573065.1 | Gene: | CG8944 / 32517 | FlyBaseID: | FBgn0030680 | Length: | 762 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001129369.1 | Gene: | Zfp707 / 315088 | RGDID: | 1311188 | Length: | 390 | Species: | Rattus norvegicus |
Alignment Length: | 257 | Identity: | 62/257 - (24%) |
---|---|---|---|
Similarity: | 87/257 - (33%) | Gaps: | 87/257 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 497 QPSL---------GGGYYCNICSIQFHNAQEFDNHKQLHLGGVTEIKFNCELCTASFREKANYDE 552
Fly 553 HLRRHNEELFLPSLALNHSIMEGGLGDDEIGVEGEESRGSGSRRKRRHAAKATDDMVDDDDRIGG 617
Fly 618 GGGGGSGGGGTDIAKPYGCDVCRRSFATPGHLNAHRIVHQDERERCYKCDYPQCNKSFVARNSLF 682
Fly 683 EHLKQHYSNEEFKCDICGKTFKSTKNLQNHKQIHDKIKRYVCQICGSAFAQAAGLYLHKRRH 744 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8944 | NP_573065.1 | MADF_DNA_bdg | 259..344 | CDD:287510 | |
MADF | 379..472 | CDD:214738 | |||
C2H2 Zn finger | 476..496 | CDD:275368 | |||
C2H2 Zn finger | 506..526 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 537..557 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 636..656 | CDD:275368 | 6/19 (32%) | ||
zf-C2H2_8 | 639..712 | CDD:292531 | 24/72 (33%) | ||
C2H2 Zn finger | 666..688 | CDD:275368 | 6/21 (29%) | ||
zf-C2H2 | 694..716 | CDD:278523 | 11/21 (52%) | ||
C2H2 Zn finger | 696..716 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 708..733 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 724..744 | CDD:275368 | 8/19 (42%) | ||
Zfp707 | NP_001129369.1 | KRAB | 40..100 | CDD:214630 | |
KRAB | 40..76 | CDD:279668 | |||
C2H2 Zn finger | 197..217 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 225..245 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 237..261 | CDD:290200 | 10/94 (11%) | ||
COG5048 | <249..385 | CDD:227381 | 42/113 (37%) | ||
C2H2 Zn finger | 253..273 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 266..290 | CDD:290200 | 9/27 (33%) | ||
zf-C2H2 | 279..301 | CDD:278523 | 7/23 (30%) | ||
C2H2 Zn finger | 281..301 | CDD:275368 | 6/21 (29%) | ||
zf-H2C2_2 | 293..318 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 309..329 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 321..344 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 337..357 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 365..385 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24390 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |