| Sequence 1: | NP_573065.1 | Gene: | CG8944 / 32517 | FlyBaseID: | FBgn0030680 | Length: | 762 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_017456046.1 | Gene: | Zfp438 / 307024 | RGDID: | 1307214 | Length: | 800 | Species: | Rattus norvegicus |
| Alignment Length: | 196 | Identity: | 45/196 - (22%) |
|---|---|---|---|
| Similarity: | 64/196 - (32%) | Gaps: | 69/196 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 626 GGTDIAKPYG-CDVCRRSFATPGHLNAHRIVHQDERERCYKCDYPQCNKSFVARNSLFEHLKQHY 689
Fly 690 SNEEFK----CDICGKTFKSTKNLQNH-KQIH--------------------------------- 716
Fly 717 -------------------DKIKRYV----CQICGSAFAQAAGLYLHKRRHNRP-NGAVGAVGRS 757
Fly 758 G 758 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG8944 | NP_573065.1 | MADF_DNA_bdg | 259..344 | CDD:287510 | |
| MADF | 379..472 | CDD:214738 | |||
| C2H2 Zn finger | 476..496 | CDD:275368 | |||
| C2H2 Zn finger | 506..526 | CDD:275368 | |||
| C2H2 Zn finger | 537..557 | CDD:275368 | |||
| C2H2 Zn finger | 636..656 | CDD:275368 | 7/19 (37%) | ||
| zf-C2H2_8 | 639..712 | CDD:292531 | 22/76 (29%) | ||
| C2H2 Zn finger | 666..688 | CDD:275368 | 8/21 (38%) | ||
| zf-C2H2 | 694..716 | CDD:278523 | 7/26 (27%) | ||
| C2H2 Zn finger | 696..716 | CDD:275368 | 6/20 (30%) | ||
| zf-H2C2_2 | 708..733 | CDD:290200 | 9/81 (11%) | ||
| C2H2 Zn finger | 724..744 | CDD:275368 | 7/19 (37%) | ||
| Zfp438 | XP_017456046.1 | C2H2 Zn finger | 497..517 | CDD:275368 | 7/19 (37%) |
| zf-H2C2_2 | 509..534 | CDD:290200 | 9/28 (32%) | ||
| C2H2 Zn finger | 525..545 | CDD:275368 | 8/21 (38%) | ||
| C2H2 Zn finger | 557..575 | CDD:275368 | 5/17 (29%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24390 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||