DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8944 and ZNF524

DIOPT Version :9

Sequence 1:NP_573065.1 Gene:CG8944 / 32517 FlyBaseID:FBgn0030680 Length:762 Species:Drosophila melanogaster
Sequence 2:XP_011524789.1 Gene:ZNF524 / 147807 HGNCID:28322 Length:370 Species:Homo sapiens


Alignment Length:146 Identity:43/146 - (29%)
Similarity:64/146 - (43%) Gaps:9/146 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   608 MVDDDD---RIGGGGGGGSGGGGTDIAKPYGCDVCRRSFATPGHLNAHRIVHQDERERCYKCDYP 669
            ::||..   .:..|...|..|.|...| |:.|.||.|:|.....|..|.|.|.:.:.  ::|.. 
Human   192 LIDDQGVPYTVSEGSAAGPEGSGPRKA-PHFCPVCLRAFPYLSDLERHSISHSELKP--HQCKV- 252

  Fly   670 QCNKSFVARNSLFEHLKQHYSNEEFKCDICGKTFKSTKNLQNHKQIHDKIKRYVCQICGSAFAQA 734
             |.|:|...:.|..|...|.....|:|.:|.:.|:....|.:|.::|...:.|.|.||...|.:|
Human   253 -CGKTFKRSSHLRRHCNIHAGLRPFRCPLCPRRFREAGELAHHHRVHSGERPYQCPICRLRFTEA 316

  Fly   735 AGLYLH-KRRHNRPNG 749
            ..|..| ||:|....|
Human   317 NTLRRHAKRKHPEAMG 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8944NP_573065.1 MADF_DNA_bdg 259..344 CDD:287510
MADF 379..472 CDD:214738
C2H2 Zn finger 476..496 CDD:275368
C2H2 Zn finger 506..526 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 636..656 CDD:275368 8/19 (42%)
zf-C2H2_8 639..712 CDD:292531 19/72 (26%)
C2H2 Zn finger 666..688 CDD:275368 6/21 (29%)
zf-C2H2 694..716 CDD:278523 6/21 (29%)
C2H2 Zn finger 696..716 CDD:275368 5/19 (26%)
zf-H2C2_2 708..733 CDD:290200 8/24 (33%)
C2H2 Zn finger 724..744 CDD:275368 9/20 (45%)
ZNF524XP_011524789.1 COG5048 <219..>283 CDD:227381 20/67 (30%)
C2H2 Zn finger 222..242 CDD:275368 8/19 (42%)
zf-H2C2_2 234..259 CDD:290200 8/28 (29%)
C2H2 Zn finger 250..270 CDD:275368 6/21 (29%)
zf-H2C2_2 262..285 CDD:290200 6/22 (27%)
C2H2 Zn finger 278..298 CDD:275368 5/19 (26%)
zf-H2C2_2 290..314 CDD:290200 7/23 (30%)
C2H2 Zn finger 306..327 CDD:275368 9/20 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.