DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8944 and ZNF358

DIOPT Version :9

Sequence 1:NP_573065.1 Gene:CG8944 / 32517 FlyBaseID:FBgn0030680 Length:762 Species:Drosophila melanogaster
Sequence 2:NP_060553.4 Gene:ZNF358 / 140467 HGNCID:16838 Length:568 Species:Homo sapiens


Alignment Length:323 Identity:79/323 - (24%)
Similarity:115/323 - (35%) Gaps:95/323 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   473 PFKCAHCPEIVQTLRELDLHMLTH---QPSLGGGYYCNICSIQFHNAQEFDNHKQLHLGGVTEIK 534
            ||.|..|....:....|..|..||   :|     |.|..|...|.:......|:.:|.|.   ..
Human   150 PFSCPDCGRAFRRSSGLSQHRRTHSGEKP-----YRCPDCGKSFSHGATLAQHRGIHTGA---RP 206

  Fly   535 FNCELCTASFREKANYDEHLRRHNEELFLPSLALNHSIMEGGLGDDEIGVEGEESRGSGS---RR 596
            :.|..|..:|..::...:|...|:.|      ..:|..:.|            ::.|.||   :.
Human   207 YQCAACGKAFGWRSTLLKHRSSHSGE------KPHHCPVCG------------KAFGHGSLLAQH 253

  Fly   597 KRRHAAKATDDMVDDDDRIGGGGGGGSGGGGTDIAKPYGCDVCRRSFATPGHLNAHRIVHQDERE 661
            .|.|                         ||   .:|:.|.||.:.|.....|..|...|..||.
Human   254 LRTH-------------------------GG---PRPHKCPVCAKGFGQGSALLKHLRTHTGERP 290

  Fly   662 RCYKCDYPQCNKSFVARNSLFEHLKQHYSNEEFKCDICGKTFKSTKNLQNHKQIHDKIKRYV--- 723
              |.|  |||.|:|...::|.:|.:.|.:...::|..|||.|..:.|||:|.:||...:.|.   
Human   291 --YPC--PQCGKAFGQSSALLQHQRTHTAERPYRCPHCGKAFGQSSNLQHHLRIHTGERPYACPH 351

  Fly   724 -------------------------CQICGSAFAQAAGLYLHKRRHNRPNGAVGAVGRSGRSS 761
                                     ||:||.||.||:.|..|||.|   .||..|...:..::
Human   352 CSKAFGQSSALLQHLHVHSGERPYRCQLCGKAFGQASSLTKHKRVH---EGAAAAAAAAAAAA 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8944NP_573065.1 MADF_DNA_bdg 259..344 CDD:287510
MADF 379..472 CDD:214738
C2H2 Zn finger 476..496 CDD:275368 4/19 (21%)
C2H2 Zn finger 506..526 CDD:275368 4/19 (21%)
C2H2 Zn finger 537..557 CDD:275368 4/19 (21%)
C2H2 Zn finger 636..656 CDD:275368 6/19 (32%)
zf-C2H2_8 639..712 CDD:292531 25/72 (35%)
C2H2 Zn finger 666..688 CDD:275368 8/21 (38%)
zf-C2H2 694..716 CDD:278523 9/21 (43%)
C2H2 Zn finger 696..716 CDD:275368 9/19 (47%)
zf-H2C2_2 708..733 CDD:290200 13/52 (25%)
C2H2 Zn finger 724..744 CDD:275368 12/19 (63%)
ZNF358NP_060553.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..117
COG5048 <35..339 CDD:227381 60/246 (24%)
lambda-1 108..>174 CDD:212564 7/23 (30%)
zf-C2H2 151..173 CDD:278523 5/21 (24%)
C2H2 Zn finger 153..173 CDD:275368 4/19 (21%)
zf-H2C2_2 166..190 CDD:290200 9/28 (32%)
C2H2 Zn finger 181..201 CDD:275368 4/19 (21%)
zf-H2C2_2 194..216 CDD:290200 5/24 (21%)
C2H2 Zn finger 209..229 CDD:275368 4/19 (21%)
zf-H2C2_2 222..244 CDD:290200 5/39 (13%)
C2H2 Zn finger 237..257 CDD:275368 5/31 (16%)
zf-H2C2_2 250..272 CDD:290200 8/49 (16%)
C2H2 Zn finger 265..285 CDD:275368 6/19 (32%)
zf-H2C2_2 277..300 CDD:290200 11/26 (42%)
zf-C2H2_8 292..370 CDD:292531 21/79 (27%)
C2H2 Zn finger 293..313 CDD:275368 8/21 (38%)
zf-H2C2_2 305..328 CDD:290200 7/22 (32%)
C2H2 Zn finger 321..341 CDD:275368 9/19 (47%)
zf-H2C2_2 333..356 CDD:290200 7/22 (32%)
C2H2 Zn finger 349..369 CDD:275368 0/19 (0%)
zf-H2C2_2 361..384 CDD:290200 4/22 (18%)
zf-C2H2 375..397 CDD:278523 12/21 (57%)
C2H2 Zn finger 377..397 CDD:275368 12/19 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 448..568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.