DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8944 and Snai1

DIOPT Version :9

Sequence 1:	NP_573065.1	Gene:	CG8944 / 32517	FlyBaseID:	FBgn0030680	Length:	762	Species:	Drosophila melanogaster
Sequence 2:	NP_446257.1	Gene:	Snai1 / 116490	RGDID:	620758	Length:	264	Species:	Rattus norvegicus

Alignment Length:	118	Identity:	34/118 - (28%)
Similarity:	51/118 - (43%)	Gaps:	8/118 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   632 KPYGCDVCRRSFATPGHLNAHRIVHQDERERCYKCDYPQCNKSFVARNSLFEHLKQHYSNEEFKC 696
            |.:.|..|.:.:.:.|.|..|      .|.....|....|.|:|.....|..|::.|...:.|.|
  Rat   152 KAFNCKYCNKEYLSLGALKMH------IRSHTLPCVCTTCGKAFSRPWLLQGHVRTHTGEKPFSC 210

  Fly   697 DICGKTFKSTKNLQNHKQIHDKIKRYVCQICGSAFAQAAGLYLHKRRHNRPNG 749
            ..|.:.|....||:.|.|.|..:|||.||.|...|::.:  .|||.:.:..:|
  Rat   211 SHCNRAFADRSNLRAHLQTHSDVKRYQCQACARTFSRMS--LLHKHQESGCSG 261

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8944	NP_573065.1	MADF_DNA_bdg	259..344	CDD:287510
		MADF	379..472	CDD:214738
		C2H2 Zn finger	476..496	CDD:275368
		C2H2 Zn finger	506..526	CDD:275368
		C2H2 Zn finger	537..557	CDD:275368
		C2H2 Zn finger	636..656	CDD:275368	5/19 (26%)
		zf-C2H2_8	639..712	CDD:292531	18/72 (25%)
		C2H2 Zn finger	666..688	CDD:275368	6/21 (29%)
		zf-C2H2	694..716	CDD:278523	8/21 (38%)
		C2H2 Zn finger	696..716	CDD:275368	7/19 (37%)
		zf-H2C2_2	708..733	CDD:290200	12/24 (50%)
		C2H2 Zn finger	724..744	CDD:275368	7/19 (37%)
Snai1	NP_446257.1	C2H2 Zn finger	156..176	CDD:275368	6/25 (24%)
		COG5048	<177..>253	CDD:227381	24/77 (31%)
		zf-C2H2	180..202	CDD:278523	6/21 (29%)
		C2H2 Zn finger	182..202	CDD:275368	5/19 (26%)
		zf-H2C2_2	195..218	CDD:290200	6/22 (27%)
		zf-C2H2	208..230	CDD:278523	8/21 (38%)
		C2H2 Zn finger	210..230	CDD:275368	7/19 (37%)
		C2H2 Zn finger	238..255	CDD:275368	7/18 (39%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24390
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100