DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8206 and AT5G27280

DIOPT Version :10

Sequence 1:NP_573064.1 Gene:CG8206 / 32516 FlyBaseID:FBgn0030679 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_198080.1 Gene:AT5G27280 / 832786 AraportID:AT5G27280 Length:212 Species:Arabidopsis thaliana


Alignment Length:133 Identity:40/133 - (30%)
Similarity:57/133 - (42%) Gaps:22/133 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VPLTNDAE------QHLKSS-----RPAPLSIPRS---ILDACHFTAKQFDLGGSTSGNQANGSL 87
            |.|:|..|      ||.:|:     |...||...:   :|.|.  :.|.:..|....|.......
plant    38 VRLSNKKEDKDYDPQHSESNSSSLFRNRTLSNDEAMGLVLSAA--SVKGWTTGSGMEGPSLPAKT 100

  Fly    88 SPTTLKRF------RRMQRRMELVYRCKLCNTRNTKTISEEAYYSGVVILQCDGCAVDHLIKDNL 146
            ...|:..|      :..:|||.:.:.|.:|..|.|:.|:..||..|.|.:||.||.|.|.:.|||
plant   101 DTDTVSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNL 165

  Fly   147 GLF 149
            .||
plant   166 NLF 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8206NP_573064.1 zf-DNL 103..>149 CDD:461571 18/45 (40%)
AT5G27280NP_198080.1 zf-DNL 123..>168 CDD:461571 18/44 (41%)

Return to query results.
Submit another query.