DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and ARP4

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_564051.1 Gene:ARP4 / 838425 AraportID:AT1G18450 Length:441 Species:Arabidopsis thaliana


Alignment Length:474 Identity:107/474 - (22%)
Similarity:197/474 - (41%) Gaps:121/474 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AVVVLDNGAHTAKVGLANQDEPHVV-PNCI------------------------MKAKSE----R 39
            :.:|:|.|:||.|.|.|.:|.|..| |:.|                        .|.:||    :
plant     8 SAIVVDLGSHTCKAGYAGEDAPKAVFPSVIGAVDGVEAMDVDVDSTKTNSNSEDSKTESEKEKSK 72

  Fly    40 RRAFVGNQIDECRDTSALYYILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMN 104
            |:.:||:|....| ...:..:...:.|.:.:|.....:|::.| |..:........:::.||.:|
plant    73 RKLYVGSQAMSYR-RDHMEVLSPIKDGIVSDWDLVDNIWEHAF-KSCLMIDPTEHPMLLAEPPLN 135

  Fly   105 FQSIQEATLEILFEEYKVDGVYKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVP-- 167
            .|..:|...|::||:|||..::......|.:|     :..|.|     .:::|.|...|.:.|  
plant   136 TQQQREKAAELMFEKYKVPALFMAKNPVLTSF-----ATGRAT-----SLVVDCGGGSTTISPVH 190

  Fly   168 --FVLGRRVLQGIRRIDMGGKALTNQLKELISYRHLNVMDESHVVNQIKEDVCFVAEDFKQAMQV 230
              :||.:.|:..    .:||:.||:.|.:.:..:.:.:                         :.
plant   191 DGYVLQKAVVSS----PLGGEFLTDCLLKSLESKGIKI-------------------------RP 226

  Fly   231 HYSEEKRREVTV------DYVLPDFT-------------TVKRGYVRVPGKPREDEEQQ------ 270
            .|| .||:||..      |..:||.|             .:|....|||..|.:|:...      
plant   227 RYS-FKRKEVRAGEFQVEDVDIPDTTESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYSNIPTTS 290

  Fly   271 ------QMVSLCNERFTVPELLFNPSDI----GVQQV--------GIPEAVADCLKACPWEAHRE 317
                  |.:.:..:||.||:::||||.:    |:::.        |:|..|.:.:..|..:..||
plant   291 YELPDGQTLEIGADRFKVPDVMFNPSIVQTIPGMEKYAEMIPSVRGLPHMVMESINKCDVDIRRE 355

  Fly   318 LLLNILIVGGSAQFPGFLPRLKRDLRALVPDDLEVSLICPEDPV--RYA-WYGGKEVATSPNFEE 379
            |..:||:.||::.......||::||....|....|.::...:..  |:: |.||..:|:..:|::
plant   356 LYSSILLAGGTSSMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQ 420

  Fly   380 FVYTQDDYEEYGFQGINQR 398
            ..:::.:|||:|...|.::
plant   421 MWFSKSEYEEHGASYIQRK 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 107/472 (23%)
COG5277 6..391 CDD:227602 105/463 (23%)
ARP4NP_564051.1 NBD_sugar-kinase_HSP70_actin 6..440 CDD:302596 107/474 (23%)
Actin 7..441 CDD:278451 107/474 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.