DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and Actl6b

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_006504698.1 Gene:Actl6b / 83766 MGIID:1933548 Length:434 Species:Mus musculus


Alignment Length:446 Identity:93/446 - (20%)
Similarity:190/446 - (42%) Gaps:80/446 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVLDNGAHTAKVGLANQDEPHV-VPNCI----------MKAKSERRRAFVGNQIDECRDTSALY- 58
            :|.|.|:.:.:.|.|.:|.|.. .|..:          ::.:.|:.:......|    ||:||: 
Mouse    14 LVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGEKEKKGKIFHI----DTNALHV 74

  Fly    59 ------YILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILF 117
                  .:...:.|.:.:|...:.:.|:.:||. :........::::|...|.::.:|...|::|
Mouse    75 PRDGAEVMSPLKNGMIEDWECFRAILDHTYSKH-VKSEPNLHPVLMSEAPWNTRAKREKLTELMF 138

  Fly   118 EEYKVDGVYKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRID 182
            |:|.:...:....|.|.||     :..|:|     .:::|.|.:.|..:|...|..:.|||.:..
Mouse   139 EQYNIPAFFLCKTAVLTAF-----ANGRST-----GLVLDSGATHTTAIPVHDGYVLQQGIVKSP 193

  Fly   183 MGGKALTNQLKELISYRHLNVMDESHVVNQIKEDVCFVAEDFKQAMQVHY-SEEKRREVTVDY-- 244
            :.|..::.|.:||.....::::....:.  .||.|       ::....:: .:||..:|:..:  
Mouse   194 LAGDFISMQCRELFQEMAIDIIPPYMIA--AKEPV-------REGAPPNWKKKEKLPQVSKSWHN 249

  Fly   245 -----VLPDFTTVKRGYVRVPGKPREDEEQQQMVSL------------CNERFTVPELLFNPSDI 292
                 |:.||   :...::|...|.:::...||.::            ..||..:||.||:||::
Mouse   250 YMCNEVIQDF---QASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERLRIPEGLFDPSNV 311

  Fly   293 ----GVQQVGIPEAVADCLKAC-----PWEA---HRELLLNILIVGGSAQFPGFLPRLKRDLRAL 345
                |...:|:...|...:..|     |.:|   .:.|..::::.||:....||..||.|:|...
Mouse   312 KGLSGNTMLGVGHVVTTSIGMCDIDIRPVDASPCSQGLYGSVIVTGGNTLLQGFTDRLNRELSQK 376

  Fly   346 VPDDLEVSLICPEDPVR---YAWYGGKEVATSPNFEEFVYTQDDYEEYGFQGINQR 398
            .|..:.:.||.....:.   ..|.||..:|:...|::...::.:|||.|.|.:.::
Mouse   377 TPPSMRLKLIASNSTMERKFSPWIGGSILASLGTFQQMWISKQEYEEGGKQCVERK 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 93/444 (21%)
COG5277 6..391 CDD:227602 91/437 (21%)
Actl6bXP_006504698.1 Actin 11..434 CDD:306521 93/446 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.