DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and AT2G42170

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001323727.1 Gene:AT2G42170 / 818817 AraportID:AT2G42170 Length:329 Species:Arabidopsis thaliana


Alignment Length:351 Identity:92/351 - (26%)
Similarity:165/351 - (47%) Gaps:42/351 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FVGNQIDECRDTSALYYILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQS 107
            |||:..:.......|.|  ..:.|.:.||...:.:|.:.|..: :..:.|...:::||..:|.::
plant    10 FVGDDAEARSGILTLDY--PMEHGVVSNWDDMEKIWYHTFYSE-LRVAPEEHPVLLTEAPLNPKA 71

  Fly   108 IQEATLEILFEEYKVDGVYKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGR 172
            .:|...:|:||.:.|..:|....|.|:     ..:..|||     ..::|.|...:::||...|.
plant    72 DREKMTQIMFETFAVPSMYIGMQAALS-----LHASGRTT-----GTVLDSGDGVSYIVPIYEGS 126

  Fly   173 RVLQGIRRIDMGGKALTNQLKELISYRHLNVMDESHVVNQIKEDVCFVAEDFKQAMQVHYSEEKR 237
            .:...|.|:|:.|:.|||.|.:::..|.. ...|..||..|||...::|.|::|.|     |:..
plant   127 ALPHAILRLDLAGRHLTNYLMKIMMERGY-TSAEREVVRDIKEQFGYIALDYEQEM-----EKAT 185

  Fly   238 REVTVD--YVLPDFTTVKRGYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIP 300
            :...:|  |.|||                     .|::::..|||..||:||.||.||::..||.
plant   186 KSSAIDRTYELPD---------------------GQVITIGAERFRCPEVLFQPSLIGMETSGIH 229

  Fly   301 EAVADCLKACPWEAHRELLLNILIVGGSAQFPGFLPRLKRDLRALVPDDLEVSLICPEDPVRYAW 365
            |...:.:..|..:..::|..||::.||:..|.|...|:.:::.||...::.:.::.|.:.....|
plant   230 EKTYNSIMKCDDDIRKDLYGNIVLSGGTTMFRGIEERMTKEINALAAANMRIKIVAPPERKYSVW 294

  Fly   366 YGGKEVATSPNFEEFVYTQDDYEEYG 391
            .||..:|:...:|:...|:.:|||.|
plant   295 IGGSILASLSTYEQMWITKAEYEENG 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 92/351 (26%)
COG5277 6..391 CDD:227602 91/349 (26%)
AT2G42170NP_001323727.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54227
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.