DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and ACTL8

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_110439.2 Gene:ACTL8 / 81569 HGNCID:24018 Length:366 Species:Homo sapiens


Alignment Length:413 Identity:99/413 - (23%)
Similarity:174/413 - (42%) Gaps:73/413 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANAVVVLDNGAHTAKVGLANQDEPHVV-PNCI--MKAKSE------RRRAFVGNQIDECRDTSA 56
            ||...|::|:|:...|.|.|..:||.:| ||.:  :..|..      |||..:|  ||.|...:.
Human     1 MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLG--IDICHPDTF 63

  Fly    57 LYYILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRN-------IVITEPQMNFQSIQEATLE 114
            .|.|   :||.:|||...:.:|.::         |||..       ::|||..:...:.::..||
Human    64 SYPI---ERGRILNWEGVQYLWSFV---------LENHRREQEVPPVIITETPLREPADRKKMLE 116

  Fly   115 ILFEEYKVDGVYKTTAADLAAFNYVADSEERTTMES--LNCIIIDVGYSFTHVVPFVLGRRVLQG 177
            ||||...|..|            .:||..:.:...|  |..:::|.||..|.|.||..||.:...
Human   117 ILFELLHVPSV------------LLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPAS 169

  Fly   178 IRRIDMGGKALTNQL-----KELISYRHLNVMDESHVVNQIKEDVCFVAEDFKQAMQVHYSEEKR 237
            .:.::..|:.|:..|     ||....|.|..: |:..|.|:.:  |:|.::..:|:.....::..
Human   170 GKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQL-ETVAVTQMNK--CYVPQNLGEALDFRERQQSA 231

  Fly   238 REVTVDYVLPDFTTVKRGYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEA 302
            .:.:..|.|||.:.|:                     |...:...||:.|:|.........||.|
Human   232 LDESNTYQLPDGSRVE---------------------LTPMQRVAPEMFFSPQVFEQPGPSIPRA 275

  Fly   303 VADCLKACPWEAHRELLLNILIVGGSAQFPGFLPRLKRDLRALVPDDLEVSLICPEDPVRYAWYG 367
            :.:.:::|.......|:.:::..||:..:|||..||.|:|........:.::....:.....|.|
Human   276 IVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLG 340

  Fly   368 GKEVATSPNFEEFVYTQDDYEEY 390
            ...||....::....::::|.|:
Human   341 ASVVAHLSTYQSEWMSREEYGEH 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 97/411 (24%)
COG5277 6..391 CDD:227602 97/408 (24%)
ACTL8NP_110439.2 ACTIN 4..363 CDD:214592 96/408 (24%)
NBD_sugar-kinase_HSP70_actin 7..362 CDD:302596 95/404 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.