DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and POTEF

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_016860322.1 Gene:POTEF / 728378 HGNCID:33905 Length:1085 Species:Homo sapiens


Alignment Length:399 Identity:104/399 - (26%)
Similarity:188/399 - (47%) Gaps:49/399 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AVVVLDNGAHTAKVGLANQDEPHVV-PNCIMKAKSE-------RRRAFVGNQIDECRDTSALYYI 60
            ||:|:|||:...|.|.|..|.|..| |:.:.:.:.:       ::.::||.:....|....|.| 
Human   716 AVLVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRQQGMMGGMHQKESYVGKEAQSKRGILTLKY- 779

  Fly    61 LAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVDGV 125
             ..:.|.:.||...:.:|.:.|..: :..:.|...:::||..:|.::.:|...:|:||.:....:
Human   780 -PMEHGIITNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEATLNPKANREKMTQIMFETFNTPAM 842

  Fly   126 YKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTN 190
            |....|.|:.:     :..|||     .|::|.|...||.||...|..:.....|:|:.|:.|.:
Human   843 YVAIQAVLSLY-----TSGRTT-----GIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELPD 897

  Fly   191 QLKELIS---YRHLNVMDESHVVNQIKEDVCFVAEDFKQAMQVHYSEEKRREVTVDYVLPDFTTV 252
            .|.::::   || ...|.|..:|..|||.:|:||.||:|.|....|.....:   .|.|||    
Human   898 YLMKILTEHGYR-FTTMAEREIVRDIKEKLCYVALDFEQEMATVASSSSLEK---SYELPD---- 954

  Fly   253 KRGYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAHRE 317
                             .|::::.||||..||.||.|..:|::..||.|...:.:.....:..::
Human   955 -----------------GQVITIGNERFRCPEALFQPCFLGMESCGIHETTFNSIMKSDVDIRKD 1002

  Fly   318 LLLNILIVGGSAQFPGFLPRLKRDLRALVPDDLEVSLICPEDPVRYAWYGGKEVATSPNFEEFVY 382
            |..|.::.||:..:||...|:::::.||.|..:::.:|.|.......|.||..:|:...|::...
Human  1003 LYTNTVLSGGTTMYPGMAHRMQKEIAALAPSMMKIRIIAPPKRKYSVWVGGSILASLSTFQQMWI 1067

  Fly   383 TQDDYEEYG 391
            ::.:|:|.|
Human  1068 SKQEYDESG 1076

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 104/399 (26%)
COG5277 6..391 CDD:227602 101/395 (26%)
POTEFXP_016860322.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.