DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and Actl10

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001165111.1 Gene:Actl10 / 70362 MGIID:1917612 Length:346 Species:Mus musculus


Alignment Length:340 Identity:76/340 - (22%)
Similarity:134/340 - (39%) Gaps:54/340 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 QRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVDGVYKT 128
            :.|.:::|...:.:|:.:. ..|:....|...:::::........:|...|:|||...|...:..
Mouse    40 KHGVVVDWDALEGLWERLM-VGGLQVHPEQWPVLVSDSPSAPPKGREKVAELLFEALTVPACHMA 103

  Fly   129 TAADLA-----AFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKAL 188
            ..|.||     ||:.:|               ::.|....|..|...|....:...|:::.|..|
Mouse   104 NTALLALCSIGAFSGLA---------------VEAGAGVCHATPIYAGHSWHKATFRLNVAGSTL 153

  Fly   189 TNQLKELI--SYRHLNVMDESH-VVNQIKEDVCFVAEDFKQAMQVHYSEEKRREVTVDYVLPDFT 250
            :...::|:  :...|.:...|. .|.|:|:..|:|:.||    |....:..|.:...      |.
Mouse   154 SRYFRDLLVAACPDLQLQGLSRKTVTQLKKRCCYVSLDF----QGDICDPARHQRAC------FC 208

  Fly   251 TVKRGYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAH 315
            .....|||                |.:|||..||.:|.||.:|..:.|:|......|:..|....
Mouse   209 LGNGCYVR----------------LGSERFRCPEPIFQPSLLGHPEPGLPTLAFQALQKIPTTLR 257

  Fly   316 RELLLNILIVGGSAQFPGFLPRLKRDLRALVP----DDLEVSLICPEDPVRYAWYGGKEVATSPN 376
            ..|...:::.|||..||||:.|:..:|.|...    ..|:..|:.........|.||..:|:..:
Mouse   258 TRLANTVVLAGGSTLFPGFVERMNLELEAQCRRHGYPALQPCLVAHPGRDTAVWTGGSMMASLNS 322

  Fly   377 FEEFVYTQDDYEEYG 391
            |:....|:..|:|:|
Mouse   323 FQCRWMTRAMYQEHG 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 76/340 (22%)
COG5277 6..391 CDD:227602 75/338 (22%)
Actl10NP_001165111.1 NBD_sugar-kinase_HSP70_actin 37..341 CDD:302596 76/340 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.