DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and Potef

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_002728578.2 Gene:Potef / 684969 RGDID:1584390 Length:414 Species:Rattus norvegicus


Alignment Length:398 Identity:105/398 - (26%)
Similarity:191/398 - (47%) Gaps:47/398 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AVVVLDNGAHTAKVGLANQDEPHVV-PNCIMKAKSE-------RRRAFVGNQIDECRDTSALYYI 60
            |.:|:|||:...|.|.|..|.|..| |:.:.:.:.:       ::.::||::....|....|.| 
  Rat    45 AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKY- 108

  Fly    61 LAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVDGV 125
             ..:.|.:.||...:.:|.:.|..: :..:.|...:::||..:|.::.:|...:|:||.:....:
  Rat   109 -PNEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM 171

  Fly   126 YKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTN 190
            |....|.|:.:     :..|||     .|::|.|...||.||...|..:...|.|:|:.|:.||:
  Rat   172 YVAIQAVLSLY-----ASGRTT-----GIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTD 226

  Fly   191 QLKELISYR--HLNVMDESHVVNQIKEDVCFVAEDFKQAMQVHYSEEKRREVTVDYVLPDFTTVK 253
            .|.::::.|  ......|..:|..|||.:|:||.||:|.|....|.....:   .|.|||     
  Rat   227 YLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEK---SYELPD----- 283

  Fly   254 RGYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAHREL 318
                            .|::::.||||..||.||.||.:|::..||.|...:.:..|..:..::|
  Rat   284 ----------------GQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDL 332

  Fly   319 LLNILIVGGSAQFPGFLPRLKRDLRALVPDDLEVSLICPEDPVRYAWYGGKEVATSPNFEEFVYT 383
            ..|.::.||:..:||...|:::::.||.|..:::.:|.|.:.....|.||..:|:...|::...:
  Rat   333 YANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 397

  Fly   384 QDDYEEYG 391
            :.:|:|.|
  Rat   398 KQEYDESG 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 105/398 (26%)
COG5277 6..391 CDD:227602 103/394 (26%)
PotefXP_002728578.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.