DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and Actr2

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001349828.1 Gene:Actr2 / 66713 MGIID:1913963 Length:399 Species:Mus musculus


Alignment Length:420 Identity:117/420 - (27%)
Similarity:181/420 - (43%) Gaps:73/420 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVVLDNGAHTAKVGLANQDEP-HVVPNCI-------------MKAKSERRR-AFVGNQIDECRDT 54
            |||.|||....|.|.|..:.| |:.|..:             ::.|:.::. ..||::..|.|..
Mouse     8 VVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKNNKKMDLMVGDEASELRSM 72

  Fly    55 SALYYILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEE 119
            ..:.|  ..:.|.:.||...|.:|||.|..:.:.....|..|::|||.||....:|..:|::||.
Mouse    73 LEVNY--PMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVEVMFET 135

  Fly   120 YKVDGVYKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMG 184
            |:..|||....|.|..:          ....|..:::|.|...||:.|...|..:....||:|:.
Mouse   136 YQFSGVYVAIQAVLTLY----------AQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIA 190

  Fly   185 GKALTNQLKELISYR--HLNVMDESHVVNQIKEDVCFVAEDFKQAMQVHYSEEK-RREVTV---D 243
            |:.:|..|.:|:..|  ..|...:...|..|||.:|:|..:.:|       |:| ..|.||   .
Mouse   191 GRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQ-------EQKLALETTVLVES 248

  Fly   244 YVLPDFTTVKRGYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLK 308
            |.|||...:|.|                     .|||..||.||.|..|.|:.||:.|.:.:.::
Mouse   249 YTLPDGRIIKVG---------------------GERFEAPEALFQPHLINVEGVGVAELLFNTIQ 292

  Fly   309 ACPWEAHRELLLNILIVGGSAQFPGFLPRLKRDLRALV--------PDDLEVSLICPEDPVR--- 362
            |...:...|...:|::.|||..:||...||:|:|:.|.        .:.|....|..|||.|   
Mouse   293 AADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKH 357

  Fly   363 YAWYGGKEVA-TSPNFEEFVYTQDDYEEYG 391
            ..:.||..:| ...:.:.|..|:.:|:|.|
Mouse   358 MVFLGGAVLADIMKDKDNFWMTRQEYQEKG 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 117/420 (28%)
COG5277 6..391 CDD:227602 115/417 (28%)
Actr2NP_001349828.1 ACTIN 6..393 CDD:214592 117/420 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.