DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and POTEJ

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_011509985.1 Gene:POTEJ / 653781 HGNCID:37094 Length:1048 Species:Homo sapiens


Alignment Length:398 Identity:105/398 - (26%)
Similarity:186/398 - (46%) Gaps:47/398 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AVVVLDNGAHTAKVGLANQDEPHVV-PNCI-------MKAKSERRRAFVGNQIDECRDTSALYYI 60
            ||:|:|||:...|.|.|..|.|..| |:.:       |.....::.::||.:....|....|.| 
Human   679 AVLVIDNGSGMCKAGFAGDDAPRAVFPSIVGCPRQQGMMGGMHQKESYVGKEAQSKRGILTLKY- 742

  Fly    61 LAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVDGV 125
             ..:.|.:.||...:.:|.:.|..: :..:.|...|::||..:|.::.:|...:|:||.:....:
Human   743 -PMEHGIITNWDDMEKIWHHTFYNE-LRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAM 805

  Fly   126 YKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTN 190
            |....|.|:.:     :..|||     .|::|.|...||.||...|..:.....|:|:.|:.||:
Human   806 YVAIQAMLSLY-----TSGRTT-----GIVMDSGDGVTHTVPIYDGNALPHATLRLDLAGRELTD 860

  Fly   191 QLKELISYR--HLNVMDESHVVNQIKEDVCFVAEDFKQAMQVHYSEEKRREVTVDYVLPDFTTVK 253
            .|.::::.|  ....|.|..:|..|||.:|:||.||:|.|.:..|.....:   .|.|||     
Human   861 YLMKILTERGYRFTTMAEREIVRDIKEKLCYVALDFEQEMAMVASSSSLEK---SYELPD----- 917

  Fly   254 RGYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAHREL 318
                            .|::::.||.|..||.||.|..:|::..||.|...:.:.....:..::|
Human   918 ----------------GQVITISNEWFRCPEALFQPCFLGMESCGIHETTFNSIMKSDVDIRKDL 966

  Fly   319 LLNILIVGGSAQFPGFLPRLKRDLRALVPDDLEVSLICPEDPVRYAWYGGKEVATSPNFEEFVYT 383
            ..|.::.||:..:||...|:::::.||.|..:::.:|.|.......|.||..:|:...|::...:
Human   967 YTNTVLSGGTTMYPGMAHRMQKEIAALAPSMMKIRIIAPPKRKYSVWVGGSILASLSTFQQMWIS 1031

  Fly   384 QDDYEEYG 391
            :.:|:|.|
Human  1032 KQEYDESG 1039

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 105/398 (26%)
COG5277 6..391 CDD:227602 102/394 (26%)
POTEJXP_011509985.1 Ank_2 106..209 CDD:289560
ANK 130..265 CDD:238125
ANK repeat 137..166 CDD:293786
ANK repeat 168..209 CDD:293786
ANK 206..330 CDD:238125
ANK repeat 211..242 CDD:293786
Ank_2 216..308 CDD:289560
ANK repeat 244..275 CDD:293786
ANK repeat 277..308 CDD:293786
NBD_sugar-kinase_HSP70_actin 674..1048 CDD:302596 105/398 (26%)
ACTIN 678..1048 CDD:214592 105/398 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.