DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and POTEI

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001358855.1 Gene:POTEI / 653269 HGNCID:37093 Length:1097 Species:Homo sapiens


Alignment Length:398 Identity:105/398 - (26%)
Similarity:188/398 - (47%) Gaps:47/398 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AVVVLDNGAHTAKVGLANQDEPHVV-PNCIMKAKSE-------RRRAFVGNQIDECRDTSALYYI 60
            ||:|:|||:...|.|.|..|.|..| |:.:.:.:.:       ::.::||.:....|....|.| 
Human   728 AVLVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRQQGMMGGMHQKESYVGKEAQSKRGILTLKY- 791

  Fly    61 LAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVDGV 125
             ..:.|.:.||...:.:|.:.|..: :..:.|...|::||..:|.::.:|...:|:||.:....:
Human   792 -PMEHGIITNWDDMEKIWHHTFYNE-LRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAM 854

  Fly   126 YKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTN 190
            |....|.|:.:     :..|||     .|::|.|...||.||...|..:.....|:|:.|:.||:
Human   855 YVAIQAMLSLY-----TSGRTT-----GIVMDSGDGVTHTVPIYDGNALPHATLRLDLAGRELTD 909

  Fly   191 QLKELISYR--HLNVMDESHVVNQIKEDVCFVAEDFKQAMQVHYSEEKRREVTVDYVLPDFTTVK 253
            .|.::::.|  ....|.|..:|..|||.:|:||.||:|.|.:..|.....:   .|.|||     
Human   910 YLMKILTERGYRFTTMAEREIVRDIKEKLCYVALDFEQEMAMAASSSSLEK---SYELPD----- 966

  Fly   254 RGYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAHREL 318
                            .|::::.||.|..||.||.|..:|::..||.|...:.:.....:..::|
Human   967 ----------------GQVITIGNEWFRCPEALFQPCFLGMESCGIHETTFNSIMKSDVDIRKDL 1015

  Fly   319 LLNILIVGGSAQFPGFLPRLKRDLRALVPDDLEVSLICPEDPVRYAWYGGKEVATSPNFEEFVYT 383
            ..|.::.||:..:||...|:::::.||.|..|::.:|.|.......|.||..:|:...|::...:
Human  1016 YTNTVLSGGTTMYPGMAHRMQKEIAALAPSMLKIRIIAPPKRKYSVWVGGSILASLSTFQQMWIS 1080

  Fly   384 QDDYEEYG 391
            :.:|:|.|
Human  1081 KQEYDESG 1088

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 105/398 (26%)
COG5277 6..391 CDD:227602 102/394 (26%)
POTEINP_001358855.1 Ank_2 158..>361 CDD:393464
ANK repeat 174..203 CDD:293786
ANK repeat 205..236 CDD:293786
ANK repeat 238..269 CDD:293786
ANK repeat 271..302 CDD:293786
ANK repeat 304..335 CDD:293786
CCDC144C 670..>723 CDD:373382
NBD_sugar-kinase_HSP70_actin 723..1097 CDD:388382 105/398 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.