DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and si:ch211-241j12.3

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_017207998.2 Gene:si:ch211-241j12.3 / 566552 ZFINID:ZDB-GENE-040724-72 Length:1245 Species:Danio rerio


Alignment Length:400 Identity:113/400 - (28%)
Similarity:183/400 - (45%) Gaps:54/400 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVLDNGAHTAKVGLANQDEPHVV-PNCIMKAKSER-------RRAFVGNQIDECRDTSALYYILA 62
            :|||:|:...|.|.|:||.|..| |..|.:.|.|.       |..:||:.....|....|.|  .
Zfish   881 IVLDSGSGLMKAGFADQDLPAAVFPTVIGRPKYEEVMNSCVDRELYVGHDAQHMRGVLTLRY--P 943

  Fly    63 FQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVDGVYK 127
            .:.|.:.||...:.:|.:.|..  :..:.|:..:::||..:|....::..:|::||.:.|...:.
Zfish   944 IRHGVVSNWDEMEMLWTHAFQL--LSAAPEDHPVLLTEAALNPLQNRQRMVELMFEAFSVPLTFV 1006

  Fly   128 TTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTNQL 192
            ...|.||.:     :..|||     .:::|.|...:|.||...|..:...::|:|:.|..:|.||
Zfish  1007 AVQAVLALY-----ASGRTT-----GVVLDSGDGVSHSVPVFEGYCLPHAVQRLDLAGADVTLQL 1061

  Fly   193 KELI--SYRHLNVMDESHVVNQIKEDVCFVAEDFKQAMQVHYSEEKRREVTVDYVLPDFTTVKRG 255
            ::|:  |...|....|..:|.::||..|||:.|::       :|.|..|..:.|.|||..|    
Zfish  1062 QKLLLESGVCLRTSAELEIVREMKERCCFVSVDYE-------AEMKSSESEIQYTLPDGHT---- 1115

  Fly   256 YVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAHRELLL 320
                             |.|.::||..||:||.|..||....|:.|:|...:.....:..|..:.
Zfish  1116 -----------------VPLASQRFRAPEILFRPELIGRDHYGLHESVFRSILQSDLDLRRSFVG 1163

  Fly   321 NILIVGGSAQFPGFLPRLKRDLRALVPDDLE--VSLICPEDPVRYAWYGGKEVATSPNFEEFVYT 383
            |||:.||:....|...||:.::||:||.||.  |.:..|.|.....|.||..:|:.|..:....:
Zfish  1164 NILLSGGNTLLSGLAERLQLEVRAMVPLDLSACVRVSSPPDRDFSVWSGGAALASLPEQQSAWIS 1228

  Fly   384 QDDYEEYGFQ 393
            ..:|||:|.|
Zfish  1229 AAEYEEFGPQ 1238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 112/399 (28%)
COG5277 6..391 CDD:227602 111/396 (28%)
si:ch211-241j12.3XP_017207998.2 Neuromodulin_N <411..625 CDD:331332
ACTIN 878..1245 CDD:214592 112/399 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.