DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and actl6b

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_005170633.1 Gene:actl6b / 553775 ZFINID:ZDB-GENE-050522-191 Length:426 Species:Danio rerio


Alignment Length:448 Identity:100/448 - (22%)
Similarity:187/448 - (41%) Gaps:92/448 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVLDNGAHTAKVGLANQDEPHV-VPNCIMKAKSERRRAFVGNQIDECR------DTSALY----- 58
            :|.|.|:.:.:.|.|.:|.|.. .|..|.....|...|.:|.:.:...      ||:||:     
Zfish    14 LVFDIGSFSTRAGYAGEDCPKADFPTTIGVNAEEEGPADMGVEQESNSGRSYYIDTTALHVPRAG 78

  Fly    59 --YILAFQRGYLLNWHTQKTVWDYIFSK-----DGIGCSLENRNIVITEPQMNFQSIQEATLEIL 116
              .|...:.|.:.:|...:.:.|:|:||     .|:      ..::::|...|.::.:|...|::
Zfish    79 VELISPLKNGMIEDWDAFQAIIDHIYSKHIKSEPGL------HPVLMSEAPWNSRAKREKLTELI 137

  Fly   117 FEEYKVDGVYKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRI 181
            ||.|.:...:....|.|.||     :..|.|     .:::|.|.:.|..:|...|..:.|||.:.
Zfish   138 FEHYNIPAFFLCKTAVLTAF-----ANGRAT-----GLVLDSGATHTTAIPVHDGYVLQQGIVKS 192

  Fly   182 DMGGKALTNQLKELISYRHLNVMDESHVVNQ-----------IKED------------VC-FVAE 222
            .:.|..::.|.:||....:::.:....:.::           .|:|            :| .|.:
Zfish   193 PLAGDFISMQCRELFQEMNIDTVPSYMIASKEPVREGAPAMWTKKDKLPPVSKSWHTFMCNEVIQ 257

  Fly   223 DFK-QAMQVH---YSEEKRREV-TVDYVLPDFTTVKRGYVRVPGKPREDEEQQQMVSLCNERFTV 282
            ||: ..:||.   |.|:...:: ||.|.:|.      ||....|.               ||..:
Zfish   258 DFQASVLQVSDSPYDEQVAAQMPTVHYEMPS------GYSTDFGA---------------ERLRI 301

  Fly   283 PELLFNPSDI----GVQQVGIPEAVADCLKACPWEAHRELLLNILIVGGSAQFPGFLPRLKRDLR 343
            ||.||:||::    |...:|:...|...:..|..:....|..::::.||:....||..||.|:|.
Zfish   302 PEGLFDPSNVKGLSGNTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTERLNRELS 366

  Fly   344 ALVPDDLEVSLICPEDPV--RY-AWYGGKEVATSPNFEEFVYTQDDYEEYGFQGINQR 398
            ...|..:.:.||.....:  |: :|.||..:|:...|::...::.:|:|.|.|.:.::
Zfish   367 QKAPPSMRLKLIACNSSIERRFSSWIGGSILASLGTFQQMWISKQEYDEGGKQSVERK 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 100/446 (22%)
COG5277 6..391 CDD:227602 98/439 (22%)
actl6bXP_005170633.1 NBD_sugar-kinase_HSP70_actin 10..425 CDD:302596 100/448 (22%)
Actin 11..426 CDD:278451 100/448 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.