DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and actr6

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001016472.1 Gene:actr6 / 549226 XenbaseID:XB-GENE-5860964 Length:396 Species:Xenopus tropicalis


Alignment Length:393 Identity:186/393 - (47%)
Similarity:261/393 - (66%) Gaps:17/393 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVLDNGAHTAKVGLANQDEPHVVPNCIMKAKSERRRAFVGNQIDECRDTSALYYILAFQRGYLLN 70
            :||||||:.||:|.:: .:..|:|||..:.|:.|.:.|..|||||.:|.|.|:|||.:|:|||:|
 Frog     4 LVLDNGAYNAKIGYSH-GQVSVIPNCQFRTKTARLKTFTANQIDEIKDPSGLFYILPYQKGYLVN 67

  Fly    71 WHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVDGVYKTTAADLAA 135
            |..|:.||||:|.|:.......:.||:||||..||.||||:..|||||||:.....:..|..|:|
 Frog    68 WDVQRQVWDYLFGKEMFQVDFPDSNIIITEPYFNFSSIQESMNEILFEEYQFQAALRINAGALSA 132

  Fly   136 FNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTNQLKELISYRH 200
            ..|..|:.     ..|.|||:|.||||||:|||...::..:||.||::|||.:||.|||:||||.
 Frog   133 HRYFRDNP-----SELCCIIVDSGYSFTHIVPFCRSKKKKEGIIRINVGGKLMTNHLKEIISYRQ 192

  Fly   201 LNVMDESHVVNQIKEDVCFVAEDFKQAMQVHYSEEKRREVTVDYVLPDFTTVKRGYVRVPGKPRE 265
            |.||||:||:||:|||||:|:.||.:.|:....:.:...|.||||||||:|:|:|:.    ||||
 Frog   193 LQVMDETHVINQVKEDVCYVSTDFYKDMETAKLKGEENSVMVDYVLPDFSTIKKGFC----KPRE 253

  Fly   266 D-------EEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAHRELLLNIL 323
            :       ...:|::.|.||||.|||:||:|||||:|::|||||:...:...|.|.......||:
 Frog   254 EMVFSGKTTAGEQILRLTNERFAVPEILFHPSDIGIQEMGIPEAIVHSINNLPEEMQPHFYKNIV 318

  Fly   324 IVGGSAQFPGFLPRLKRDLRALVPDDLEVSLICPEDPVRYAWYGGKEVATSPNFEEFVYTQDDYE 388
            :.||:..||||..|:..::|.|.|.|.:||:|.||:|:.|||.|||.::.:.:||:.|.|::|||
 Frog   319 LTGGNTLFPGFRERVFSEVRKLTPTDFDVSVILPENPISYAWEGGKIISENDDFEDMVVTREDYE 383

  Fly   389 EYG 391
            |.|
 Frog   384 ENG 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 186/393 (47%)
COG5277 6..391 CDD:227602 185/391 (47%)
actr6NP_001016472.1 ACTIN 2..394 CDD:214592 186/393 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 379 1.000 Domainoid score I841
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H6451
Inparanoid 1 1.050 379 1.000 Inparanoid score I2025
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D462325at33208
OrthoFinder 1 1.000 - - FOG0005146
OrthoInspector 1 1.000 - - oto104598
Panther 1 1.100 - - LDO PTHR11937
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R85
SonicParanoid 1 1.000 - - X3663
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.