DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and ACTL6B

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_057272.1 Gene:ACTL6B / 51412 HGNCID:160 Length:426 Species:Homo sapiens


Alignment Length:434 Identity:91/434 - (20%)
Similarity:188/434 - (43%) Gaps:64/434 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVLDNGAHTAKVGLANQDEPHV-VPNCI--MKAKSERRRAFVGNQIDECR----DTSALY----- 58
            :|.|.|:.:.:.|.|.:|.|.. .|..:  :.|:........|::..:.:    ||:||:     
Human    14 LVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDG 78

  Fly    59 --YILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYK 121
              .:...:.|.:.:|...:.:.|:.:||. :........::::|...|.::.:|...|::||:|.
Human    79 AEVMSPLKNGMIEDWECFRAILDHTYSKH-VKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYN 142

  Fly   122 VDGVYKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGK 186
            :...:....|.|.||     :..|:|     .:::|.|.:.|..:|...|..:.|||.:..:.|.
Human   143 IPAFFLCKTAVLTAF-----ANGRST-----GLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGD 197

  Fly   187 ALTNQLKELISYRHLNVMDESHVVNQIKEDVCFVAEDFKQAMQVHY-SEEKRREVTVDY------ 244
            .::.|.:||.....::::....:.  .||.|       ::....:: .:||..:|:..:      
Human   198 FISMQCRELFQEMAIDIIPPYMIA--AKEPV-------REGAPPNWKKKEKLPQVSKSWHNYMCN 253

  Fly   245 -VLPDFTTVKRGYVRVPGKPREDEEQQQMVSL------------CNERFTVPELLFNPSDI---- 292
             |:.||   :...::|...|.:::...||.::            ..||..:||.||:||::    
Human   254 EVIQDF---QASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERLRIPEGLFDPSNVKGLS 315

  Fly   293 GVQQVGIPEAVADCLKACPWEAHRELLLNILIVGGSAQFPGFLPRLKRDLRALVPDDLEVSLICP 357
            |...:|:...|...:..|..:....|..::::.||:....||..||.|:|....|..:.:.||..
Human   316 GNTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPSMRLKLIAS 380

  Fly   358 EDPVR---YAWYGGKEVATSPNFEEFVYTQDDYEEYGFQGINQR 398
            ...:.   ..|.||..:|:...|::...::.:|||.|.|.:.::
Human   381 NSTMERKFSPWIGGSILASLGTFQQMWISKQEYEEGGKQCVERK 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 91/432 (21%)
COG5277 6..391 CDD:227602 89/425 (21%)
ACTL6BNP_057272.1 Actin 11..426 CDD:394979 91/434 (21%)
Essential for mediating its function in dendritic development, may contribute to neuronal-specific targeting. /evidence=ECO:0000250|UniProtKB:Q99MR0 39..82 6/42 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.