DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and POTEE

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001077007.1 Gene:POTEE / 445582 HGNCID:33895 Length:1075 Species:Homo sapiens


Alignment Length:398 Identity:103/398 - (25%)
Similarity:186/398 - (46%) Gaps:47/398 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AVVVLDNGAHTAKVGLANQDEPHVV-PNCIMKAKSE-------RRRAFVGNQIDECRDTSALYYI 60
            ||:|:|||:...|.|.|..|.|..| |:.:.:.:.:       ::.::||.:....|....|.| 
Human   706 AVLVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRQQGMMGGMHQKESYVGKEAQSKRGILTLKY- 769

  Fly    61 LAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVDGV 125
             ..:.|.:.||...:.:|.:.|..: :..:.|...|::||..:|.::.:|...:|:||.:....:
Human   770 -PMEHGIITNWDDMEKIWHHTFYNE-LRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAM 832

  Fly   126 YKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTN 190
            |....|..:.:     :..|||     .|::|.|...||.||...|..:.....|:|:.|:.|.:
Human   833 YVAIQAVPSLY-----TSGRTT-----GIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELPD 887

  Fly   191 QLKELISYR--HLNVMDESHVVNQIKEDVCFVAEDFKQAMQVHYSEEKRREVTVDYVLPDFTTVK 253
            .|.::::.|  ....|.|..:|..|||.:|:||.||:|.|....|.....:   .|.|||     
Human   888 YLMKILTERGYRFTTMAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEK---SYELPD----- 944

  Fly   254 RGYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAHREL 318
                            .|::::.||||..||.||.|..:|::..||.|...:.:.....:..::|
Human   945 ----------------GQVITIGNERFRCPEALFQPCFLGMESCGIHETTFNSIMKSDVDIRKDL 993

  Fly   319 LLNILIVGGSAQFPGFLPRLKRDLRALVPDDLEVSLICPEDPVRYAWYGGKEVATSPNFEEFVYT 383
            ..|.::.||:..:||...|:::::.||.|..:::.:|.|.......|.||..:|:...|::...:
Human   994 YTNTVLSGGTTMYPGMAHRMQKEIAALAPSMMKIRIIAPPKRKYSVWVGGSILASLSTFQQMWIS 1058

  Fly   384 QDDYEEYG 391
            :.:|:|.|
Human  1059 KQEYDESG 1066

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 103/398 (26%)
COG5277 6..391 CDD:227602 100/394 (25%)
POTEENP_001077007.1 Ank_4 143..193 CDD:290365
ANK 167..292 CDD:238125
ANK 1 172..201
ANK repeat 174..203 CDD:293786
Ank_2 177..269 CDD:289560
ANK repeat 205..236 CDD:293786
ANK 2 205..234
ANK 233..357 CDD:238125
ANK repeat 238..269 CDD:293786
ANK 3 238..267
Ank_2 243..335 CDD:289560
ANK repeat 271..302 CDD:293786
ANK 4 271..300
ANK repeat 304..335 CDD:293786
ANK 5 304..333
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 369..530
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 544..599
NBD_sugar-kinase_HSP70_actin 701..1075 CDD:302596 103/398 (26%)
Actin-like 702..1075 103/398 (26%)
ACTIN 705..1075 CDD:214592 103/398 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.