DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and Act88F

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_524367.1 Gene:Act88F / 41885 FlyBaseID:FBgn0000047 Length:376 Species:Drosophila melanogaster


Alignment Length:406 Identity:109/406 - (26%)
Similarity:195/406 - (48%) Gaps:54/406 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVLDNGAHTAKVGLANQDEPHVV-PNCIMKAKSE-------RRRAFVGNQIDECRDTSALYYILA 62
            :|:|||:...|.|.|..|.|..| |:.:.:.:.:       ::.::||::....|....|.|  .
  Fly     9 LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKY--P 71

  Fly    63 FQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVDGVYK 127
            .:.|.:.||...:.:|.:.|..: :..:.|...:::||..:|.::.:|...:|:||.:....:|.
  Fly    72 IEHGIITNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYV 135

  Fly   128 TTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTNQL 192
            ...|.|:.:     :..|||     .|::|.|...:|.||...|..:...|.|:|:.|:.||:.|
  Fly   136 AIQAVLSLY-----ASGRTT-----GIVLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDLTDYL 190

  Fly   193 KELISYR--HLNVMDESHVVNQIKEDVCFVAEDFKQAM---QVHYSEEKRREVTVDYVLPDFTTV 252
            .::::.|  ......|..:|..|||.:|:||.||:|.|   ....|.||      .|.|||    
  Fly   191 MKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEK------SYELPD---- 245

  Fly   253 KRGYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAHRE 317
                             .|::::.||||..||.||.||.:|::..||.|.|.:.:..|..:..::
  Fly   246 -----------------GQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKD 293

  Fly   318 LLLNILIVGGSAQFPGFLPRLKRDLRALVPDDLEVSLICPEDPVRYAWYGGKEVATSPNFEEFVY 382
            |..|.::.||:..:||...|:::::.||.|..:::.:|.|.:.....|.||..:|:...|::...
  Fly   294 LYANSVLSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 358

  Fly   383 TQDDYEEYGFQGINQR 398
            ::.:|:|.| .||..|
  Fly   359 SKQEYDESG-PGIVHR 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 108/404 (27%)
COG5277 6..391 CDD:227602 105/397 (26%)
Act88FNP_524367.1 PTZ00281 1..376 CDD:173506 109/406 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467834
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.