DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and actr1b

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_998537.1 Gene:actr1b / 406681 ZFINID:ZDB-GENE-040426-2695 Length:376 Species:Danio rerio


Alignment Length:408 Identity:107/408 - (26%)
Similarity:190/408 - (46%) Gaps:50/408 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANAVVVLDNGAHTAKVGLANQDEP-HVVPNCIMKAKSERRRA-------FVGNQIDECRDTSAL 57
            :||..||:|||:...|.|.|....| :..||.:.:.|..|..|       |:|.:.:|.|...::
Zfish     7 IANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDLFIGPKAEEHRGLLSV 71

  Fly    58 YYILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKV 122
            .|  ..:.|.:.:|:..:.:|.|::||:.:....|...:::||..:|....:|...|:.||.:.|
Zfish    72 RY--PMEHGIVKDWNDMERIWQYVYSKEQLQTFSEEHPVLLTEAPLNPSKNRERAAEVFFETFNV 134

  Fly   123 DGVYKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKA 187
            ..::.:..|.|:.:     :..|||     .:::|.|...||.||...|..:...|.|:|:.|:.
Zfish   135 PALFISMQAVLSLY-----ATGRTT-----GVVLDAGDGVTHAVPIYEGFAIPHSIMRVDIAGRD 189

  Fly   188 LTNQLKELISYR--HLNVMDESHVVNQIKEDVCFVAEDFKQAMQVHYSEEKRREVTVDYVLPDFT 250
            ::..|:.|:...  ..:...|..||..|||..|:::.:.::       :|........|.|||.:
Zfish   190 VSRYLRLLLRKEGYDFHTSAEFEVVRTIKERACYLSLNPQK-------DETLETEKAQYTLPDGS 247

  Fly   251 TVKRGYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAH 315
            |:..|    |.                 ||..|||||.|..||.:..||.|.:|..::....:..
Zfish   248 TLDIG----PA-----------------RFRAPELLFRPDLIGDESEGIHEVLAFAIQKSDMDLR 291

  Fly   316 RELLLNILIVGGSAQFPGFLPRLKRDLRALVPDDLEVSLICPEDPVRYAWYGGKEVATSPNFEEF 380
            |.|..||::.|||....||..||..:::.|.|.|:::.:..|::.:...|.||..:|:...|::.
Zfish   292 RTLFSNIVLSGGSTLLKGFGDRLLSEVKKLAPKDVKIKISAPQERLYSTWIGGSILASLDTFKKM 356

  Fly   381 VYTQDDYEEYGFQGINQR 398
            ..::.:|||...:.|:::
Zfish   357 WVSKKEYEEDRARAIHRK 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 106/404 (26%)
COG5277 6..391 CDD:227602 104/394 (26%)
actr1bNP_998537.1 NBD_sugar-kinase_HSP70_actin 5..376 CDD:418402 107/408 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.