DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and actr3

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001003944.1 Gene:actr3 / 406250 ZFINID:ZDB-GENE-040428-2 Length:418 Species:Danio rerio


Alignment Length:437 Identity:113/437 - (25%)
Similarity:179/437 - (40%) Gaps:93/437 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLDNGAHTAKVGLANQDEPH-VVPNCIMKAKSERRRAFVGNQI----------------DECRDT 54
            |:|.|....|:|.|...||. ::|:||...:|    |.||:|.                ||..|.
Zfish     9 VVDCGTGYTKLGYAGNTEPQFIIPSCIAIKES----AKVGDQAQRRMMKGVDDLDFYIGDEAIDK 69

  Fly    55 SALYYILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEE 119
            .........:.|.:.:|...:...:.:..| .:....|:...::|||.:|....:|.|.||:||.
Zfish    70 PTYATKWPIRHGIVEDWDLMERFMEQVIFK-YLRAEPEDHYFLLTEPPLNTPENREYTAEIMFES 133

  Fly   120 YKVDGVYKTTAADLA-AFNYVA-DSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRID 182
            :.|.|:|....|.|| |.::.: ...|||    |...:||.|...|||:|...|..:...|:.|.
Zfish   134 FNVPGLYIAVQAVLALAASWTSRQVGERT----LTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIP 194

  Fly   183 MGGKALTNQLKELISYRHLNVMDES--HVVNQIKEDVCFVAEDFKQAMQVHYSEE---------- 235
            :.|:.:|...::|:..|.:.:..|.  .....:||...:|..|..:....:.::.          
Zfish   195 IAGRDITYFTQQLLREREVGIPPEQSLETAKAVKERFSYVCPDLVKEFSKYDTDGSKWIKQYTGI 259

  Fly   236 ---KRREVTVDYVLPDFTTVKRGYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQ-Q 296
               .::|.|:|.          ||                     |||..||:.|:|...... .
Zfish   260 NTISKKEFTIDV----------GY---------------------ERFLGPEIFFHPEFANPDFT 293

  Fly   297 VGIPEAVADCLKACPWEAHRELLLNILIVGGSAQFPGFLPRLKRDLRALV--------------- 346
            ..|.|.|.:.::.||.:..|.|..||::.|||..|..|..||:|||:..|               
Zfish   294 QPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGKL 358

  Fly   347 -PDDLEVSLICPEDPVRYA-WYGGKEVATSPNFEEFVYTQDDYEEYG 391
             |..::|.:| .....||| |:||..:|::|.|.:..:|:.||||.|
Zfish   359 KPKPIDVQVI-THHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIG 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 113/437 (26%)
COG5277 6..391 CDD:227602 112/435 (26%)
actr3NP_001003944.1 PTZ00280 2..417 CDD:240343 113/437 (26%)
COG5277 6..410 CDD:227602 113/437 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.