DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and Actrt3

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001102412.1 Gene:Actrt3 / 365763 RGDID:1561457 Length:371 Species:Rattus norvegicus


Alignment Length:404 Identity:109/404 - (26%)
Similarity:183/404 - (45%) Gaps:53/404 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVLDNGAHTAKVGLANQDEPH-VVPNCIMKAKS------ERRRAFVGNQIDECRDTSALYYILAF 63
            ||:|||:...|.|||...||. |.||.:.:.|:      .::...||:|..|.|...::.|  ..
  Rat     8 VVIDNGSGMIKAGLAGAREPQFVYPNILGRTKNHSPAADSKQELRVGDQAQERRSFLSISY--PV 70

  Fly    64 QRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVDGVYKT 128
            :||.:.:|...:.:|.:|:..: :..:..:..:::|||.:|..:.::...|:.||...|...|.:
  Rat    71 ERGLISSWGDMEIMWKHIYDYN-LNLNPSDGPVLVTEPALNPLADRQHISEVFFENLGVPAFYMS 134

  Fly   129 TAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTNQLK 193
            ..|.||.|     :...||     .::::.|...|..||...|..:..|::::::.|..|||.|.
  Rat   135 VQAVLALF-----AAGFTT-----GLVLNSGAGITQCVPIFEGYCLSHGVKQLNVAGIDLTNYLM 189

  Fly   194 ELISYRHLNVM--DESHVVNQIKEDVCFVAEDFKQAMQVHYSEEKRREVTVD--YVLPDFTTVKR 254
            .|:....:.::  .:...|..|||:.|:||        ::|.||..:|..|:  |.|||..||| 
  Rat   190 MLLKDDGIMLLRTGDRKTVTDIKENACYVA--------MNYDEEMVKESNVEKMYTLPDGKTVK- 245

  Fly   255 GYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAHRELL 319
                                |..:.|..||.||:|..:.|...||.......:..|..:......
  Rat   246 --------------------LRKQVFRCPEALFSPYLVNVDAPGIDRICFSSIMKCDADLRNSFF 290

  Fly   320 LNILIVGGSAQFPGFLPRLKRDLRALVPDDLEVSLICPEDPVRYAWYGGKEVATSPNFEEFVYTQ 384
            .||::.|||..|||...||.:|:..|.|.:..|.::.|.:.....|.||..:|:...|::...|.
  Rat   291 SNIILSGGSTSFPGLDKRLIKDVAKLAPANTTVQVVAPPERKISVWMGGSILASLSAFQDMWITA 355

  Fly   385 DDYEEYGFQGINQR 398
            .::||.|...::||
  Rat   356 AEFEEVGPNIVHQR 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 107/402 (27%)
COG5277 6..391 CDD:227602 106/395 (27%)
Actrt3NP_001102412.1 ACTIN 5..371 CDD:214592 109/404 (27%)
NBD_sugar-kinase_HSP70_actin 9..371 CDD:302596 108/403 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.