DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and Actl6a

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001034122.1 Gene:Actl6a / 361925 RGDID:1307747 Length:429 Species:Rattus norvegicus


Alignment Length:437 Identity:96/437 - (21%)
Similarity:188/437 - (43%) Gaps:67/437 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVLDNGAHTAKVGLANQDEPHVVPNCIMKAKSERRRAFVGNQIDECR----------DTSALYY- 59
            :|.|.|::|.:.|.|.:|.|.|.....:....||.......:||..:          ||:||.. 
  Rat    14 LVFDIGSYTVRAGYAGEDCPKVDFPTAIGVVLERDDGSTMMEIDGDKGKQGGPTYYIDTNALRVP 78

  Fly    60 ------ILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFE 118
                  |...:.|.:.:|.:.:.:.|:.: |..:........::::|...|.::.:|...|::||
  Rat    79 RESMEAISPLKNGMVEDWDSFQAILDHTY-KMHVKSEASLHPVLMSEAPWNTRAKREKLTELMFE 142

  Fly   119 EYKVDGVYKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDM 183
            .|.:...:....|.|.||     :..|:|     .:|:|.|.:.|..:|...|..:.|||.:..:
  Rat   143 HYSIPAFFLCKTAVLTAF-----ANGRST-----GLILDSGATHTTAIPVHDGYVLQQGIVKSPL 197

  Fly   184 GGKALTNQLKELISYRHLNVMDESHVVNQIKEDVCFVAEDFKQAMQVHYS-EEKRREVTVDY--- 244
            .|..:|.|.:||....::.::....:.::         |..::....::. :||..:||..:   
  Rat   198 AGDFITMQCRELFQEMNIELIPPYMIASK---------EAVREGSPANWKRKEKLPQVTRSWHNY 253

  Fly   245 ----VLPDFTTVKRGYVRVPGKPREDEEQQQMVSL---------CN---ERFTVPELLFNPSDI- 292
                |:.||   :...::|.....:::...||.::         |:   ||..:||.||:||:: 
  Rat   254 MCNCVIQDF---QASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVK 315

  Fly   293 ---GVQQVGIPEAVADCLKACPWEAHRELLLNILIVGGSAQFPGFLPRLKRDLRALVPDDLEVSL 354
               |...:|:...|...:..|..:....|..::::.||:.....|..||.|:|....|..:.:.|
  Rat   316 GLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKL 380

  Fly   355 ICPEDPV--RY-AWYGGKEVATSPNFEEFVYTQDDYEEYGFQGINQR 398
            |.....|  |: :|.||..:|:...|::...::.:|||.|.|.:.::
  Rat   381 IANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERK 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 96/435 (22%)
COG5277 6..391 CDD:227602 94/428 (22%)
Actl6aNP_001034122.1 Actin 11..429 CDD:394979 96/437 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.