DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and Arp10

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster


Alignment Length:391 Identity:88/391 - (22%)
Similarity:151/391 - (38%) Gaps:93/391 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVLDNGAHTAKVGLANQDEPH-VVP-NCIMKAKSERRRAFVGNQIDECRDTSALYYILAFQRGYL 68
            :|||.|....|:|.|.:..|. ::| ..:|.....|:|.|..:..:|..|....:....|.:..|
  Fly    14 IVLDIGTAYTKLGFAAEAYPRKIMPTEVVMTTTGIRKRLFDYDTPEELYDQLVDFLQTIFFKHLL 78

  Fly    69 LNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVDGVYKTTAADL 133
            :                    |.:.|..|:.|.......::|....:||..:.|..|.......:
  Fly    79 V--------------------SPKERKFVLVENVFGSTVLRETLARVLFVHFDVSSVLFVPVHLI 123

  Fly   134 AAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTNQLKELISY 198
            |.          :|:.....:::|||||.|.|:|...|.:::...:....||.|:..::|     
  Fly   124 AL----------STLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIK----- 173

  Fly   199 RHL-------NVMDESHVVNQIKEDVCFVAEDFKQAMQVHYSEEKRREV-TVDYVLPDFTTVKRG 255
            |.|       :::.|| |:..||...|||....:...:.:..|.:.... .|||::.|...|   
  Fly   174 RQLVESGVKESLLTES-VLEDIKVRTCFVTTMERAKARANGDENQPTPAPDVDYIVSDNDAV--- 234

  Fly   256 YVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAHRELLL 320
             ::|||..|| ...:.|....|||.::|.|:.             .::.|    |..:..|.|:.
  Fly   235 -IQVPGLLRE-SAYEIMFEASNERDSLPHLIL-------------RSILD----CTLDVRRALVE 280

  Fly   321 NILIVGGSAQFPGFLPRLKRDLRALVPDDLEVSLICPEDPVRY------------------AWYG 367
            ::.:|||.:...|.|.||:::|:.|:.:|       |....|:                  ||.|
  Fly   281 SVFLVGGGSMVQGLLARLRQELQHLLTED-------PFYAERFHGELQFKFFNAVGKQNFTAWLG 338

  Fly   368 G 368
            |
  Fly   339 G 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 88/391 (23%)
COG5277 6..391 CDD:227602 88/391 (23%)
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 88/391 (23%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 88/391 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467821
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11937
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.