DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and Arp2

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001259621.1 Gene:Arp2 / 32623 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster


Alignment Length:428 Identity:112/428 - (26%)
Similarity:177/428 - (41%) Gaps:85/428 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVVLDNGAHTAKVGLANQDEP-HVVPNCIMKAKSERRRA-----------------FVGNQIDEC 51
            |:|.|||....|.|.|..:.| |:.|:.:.:...   ||                 .||::..:.
  Fly     8 VIVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMI---RAVNKIGDIEVKDLHVDDLMVGDEASQL 69

  Fly    52 RDTSALYYILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEIL 116
            |....:.|  ..:.|.:.||.....||||.|....:.....|..|::|||.||....:|..:|::
  Fly    70 RSLLEVSY--PMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNREKMIEVM 132

  Fly   117 FEEYKVDGVYKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVP----FVLGRRVLQG 177
            ||:|..|..|....|.|..:          ....::.::||.|...||:.|    |.|....   
  Fly   133 FEKYGFDSAYIAIQAVLTLY----------AQGLISGVVIDSGDGVTHICPVYEEFALPHLT--- 184

  Fly   178 IRRIDMGGKALTNQLKELISYR--HLNVMDESHVVNQIKEDVCFVAEDFKQAMQVHYSEEKRREV 240
             ||:|:.|:.:|..|.:|:..|  ..|...:...|..:||.:|::..|      :...:....|.
  Fly   185 -RRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRIMKEKLCYIGYD------IEMEQRLALET 242

  Fly   241 TV---DYVLPDFTTVKRGYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEA 302
            ||   .|.|||...:|.|                     .|||..||.||.|..|.|:..||.|.
  Fly   243 TVLVESYTLPDGRVIKVG---------------------GERFEAPEALFQPHLINVEGPGIAEL 286

  Fly   303 VADCLKACPWEAHRELLLNILIVGGSAQFPGFLPRLKRDLRAL-----VPDDLEVSL---ICPED 359
            ..:.::|...:...||..:|::.|||..:||...||:|:::.|     :.:|.|...   |..||
  Fly   287 AFNTIQAADIDIRPELYKHIVLSGGSTMYPGLPSRLEREIKQLYLERVLKNDTEKLAKFKIRIED 351

  Fly   360 PVR---YAWYGGKEVA-TSPNFEEFVYTQDDYEEYGFQ 393
            |.|   ..:.||..:| .:.:.:.|..::.:|:|.|.:
  Fly   352 PPRRKDMVFIGGAVLAEVTKDRDGFWMSKQEYQEQGLK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 112/428 (26%)
COG5277 6..391 CDD:227602 110/423 (26%)
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 112/428 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467837
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.