DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and ACTL9

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_848620.3 Gene:ACTL9 / 284382 HGNCID:28494 Length:416 Species:Homo sapiens


Alignment Length:398 Identity:98/398 - (24%)
Similarity:172/398 - (43%) Gaps:54/398 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVLDNGAHTAKVGLANQDEPHVVPNCIMKAKSER--------RRAFVGNQIDECRDTSALYYILA 62
            ||:|.|..|.|||.|.|..|......|:..:.::        .:.|:|   :..|....|..:..
Human    52 VVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIG---EAARVLPELTLVQP 113

  Fly    63 FQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVDGVYK 127
            .:.|.:::|...:.:|.::...| :..:..:..::.::|..:..:.:|..:|:.||..:...:|.
Human   114 LRSGIVVDWDAAELIWRHLLEHD-LRVATHDHPLLFSDPPFSPATNREKLVEVAFESLRSPAMYV 177

  Fly   128 TTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTNQL 192
            .:.:.|:.:.:          ..::.:::|.|:..|:.||...|..:|....|:|:.|..||..|
Human   178 ASQSVLSVYAH----------GRVSGLVVDTGHGVTYTVPVFQGYNLLHATERLDLAGNNLTAFL 232

  Fly   193 KELISYRHLNV-MDESHVVNQIKEDVCFVAEDFKQAMQVHYSEEKRREVTVDYVLPDFTTVKRGY 256
            .|::....|.: ..:..:|..||...|:||.|| |..|....:|.:|.:.    |||..||..| 
Human   233 AEMLLQAGLPLGQQDLDLVENIKHHYCYVASDF-QKEQARPEQEYKRTLK----LPDGRTVTLG- 291

  Fly   257 VRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDI-GVQQVGIPEAVADCLKACPWEAHRELLL 320
                                .|.|..|||||||.:: |:..||:.......|:....|...:|..
Human   292 --------------------KELFQCPELLFNPPEVPGLSPVGLSTMAKQSLRKLSLEMRADLAQ 336

  Fly   321 NILIVGGSAQFPGFLPRLKRDLRALVPDDLEVSLICPEDPVR--YAWYGGKEVATSPNFEEFVYT 383
            |:|:.|||:.|.||..|.:.:|...:|  .|..::....|.|  ..|.||..:|:...|:.....
Human   337 NVLLCGGSSLFTGFEGRFRAELLRALP--AETHVVVAAQPTRNFSVWIGGSILASLRAFQSCWVL 399

  Fly   384 QDDYEEYG 391
            ::.|||.|
Human   400 REQYEEQG 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 98/398 (25%)
COG5277 6..391 CDD:227602 97/396 (24%)
ACTL9NP_848620.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
NBD_sugar-kinase_HSP70_actin 49..416 CDD:302596 98/398 (25%)
ACTIN 49..415 CDD:214592 98/398 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.