DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and Actr3b

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001004365.1 Gene:Actr3b / 242894 MGIID:2661120 Length:418 Species:Mus musculus


Alignment Length:438 Identity:119/438 - (27%)
Similarity:192/438 - (43%) Gaps:95/438 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLDNGAHTAKVGLANQDEPH-VVPNCIMKAKSER------RRA---------FVGNQIDECRDTS 55
            |:|.|....|:|.|...||. ::|:||...:|.:      ||.         |:|   ||..|..
Mouse     9 VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIG---DEAIDKP 70

  Fly    56 ALYYILAFQRGYLLNW-----HTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEI 115
            ........:.|.:.:|     ..::.|:.|:.::.      |:...::|||.:|....:|...||
Mouse    71 TYATKWPIRHGIVEDWDLMERFMEQVVFKYLRAEP------EDHYFLMTEPPLNTPENREYLAEI 129

  Fly   116 LFEEYKVDGVYKTTAADLA-AFNYVA-DSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGI 178
            :||.:.|.|:|....|.|| |.::.: ...|||    |..|:||.|...|||:|...|..:...|
Mouse   130 MFESFNVPGLYIAVQAVLALAASWTSRQVGERT----LTGIVIDSGDGVTHVIPVAEGYVIGSCI 190

  Fly   179 RRIDMGGKALTNQLKELISYRHLNVMDES--HVVNQIKEDVCFVAEDFKQAMQVHYSEEKRREVT 241
            :.|.:.|:.:|..:::|:..|.:.:..|.  .....|||..|                       
Mouse   191 KHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYC----------------------- 232

  Fly   242 VDYVLPDFTTVKRGYVRVPGKPREDEEQQQMVSLCN----------ERFTVPELLFNPSDIGVQ- 295
              |:.||   :.|.:.:....||:..:|...::..|          |||..||:.|:|...... 
Mouse   233 --YICPD---IVREFAKYDVDPRKWIKQYTGINAINQKKFIIDVGYERFLGPEIFFHPEFANPDF 292

  Fly   296 QVGIPEAVADCLKACPWEAHRELLLNILIVGGSAQFPGFLPRLKRDLRALVPDDLEVS------L 354
            ...|.:.|.:.:::||.:..|.|..|:::.|||..|..|..||:|||:.:|...|::|      .
Mouse   293 MESISDVVDEVIQSCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLKLSQELSGGR 357

  Fly   355 ICPEDPV----------RYA-WYGGKEVATSPNFEEFVYTQDDYEEYG 391
            |.|: ||          ||| |:||..:|::|.|.:..:|:.||||||
Mouse   358 IKPK-PVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYG 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 119/438 (27%)
COG5277 6..391 CDD:227602 117/436 (27%)
Actr3bNP_001004365.1 COG5277 1..410 CDD:227602 119/438 (27%)
PTZ00280 2..417 CDD:240343 119/438 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.