DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and Actbl2

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_780706.1 Gene:Actbl2 / 238880 MGIID:2444552 Length:376 Species:Mus musculus


Alignment Length:396 Identity:101/396 - (25%)
Similarity:186/396 - (46%) Gaps:47/396 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVLDNGAHTAKVGLANQDEPHVV-PNCIMKAKSE-------RRRAFVGNQIDECRDTSALYYILA 62
            :|:|||:...|.|....|.|..| |:.:.:.:.:       ::..:||::....|....|.|  .
Mouse     9 LVVDNGSGMCKAGFGGDDAPRAVFPSMVGRPRHQGVMVGMGQKDCYVGDEAQSKRGILTLKY--P 71

  Fly    63 FQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVDGVYK 127
            .:.|.:.||...:.:|.:.|..: :..:.:...|::||..:|.:..:|...:|:||.:....:|.
Mouse    72 IEHGVVTNWDDMEKIWYHTFYNE-LRVAPDEHPILLTEAPLNPKINREKMTQIMFEAFNTPAMYV 135

  Fly   128 TTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTNQL 192
            ...|.|:.:     :..|||     .|::|.|...||.||...|..:...|.|:|:.|:.||:.|
Mouse   136 AIQAVLSLY-----ASGRTT-----GIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYL 190

  Fly   193 KELISYRHLN--VMDESHVVNQIKEDVCFVAEDFKQAMQVHYSEEKRREVTVDYVLPDFTTVKRG 255
            .::::.|..|  ...|..:|..:||.:|:||.||:|.|....:......   .|.|||       
Mouse   191 MKILTERGYNFTTTAEREIVRDVKEKLCYVALDFEQEMVTAAASSSLER---SYELPD------- 245

  Fly   256 YVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAHRELLL 320
                          .|::::.||||..||.:|.||.:|::..||.|...:.:..|..:..::|..
Mouse   246 --------------GQVITIGNERFRCPEAIFQPSFLGIESRGIHETTFNSIMKCDVDIRKDLFA 296

  Fly   321 NILIVGGSAQFPGFLPRLKRDLRALVPDDLEVSLICPEDPVRYAWYGGKEVATSPNFEEFVYTQD 385
            |.::.|||..:||...|:::::..|.|..:::.:|.|.:.....|.||..:|:...|::...::.
Mouse   297 NTVLSGGSTMYPGIADRMQKEIVTLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ 361

  Fly   386 DYEEYG 391
            :|:|.|
Mouse   362 EYDEAG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 101/396 (26%)
COG5277 6..391 CDD:227602 100/394 (25%)
Actbl2NP_780706.1 NBD_sugar-kinase_HSP70_actin 1..376 CDD:302596 101/396 (26%)
ACTIN 7..376 CDD:214592 101/396 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54227
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.