DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and ACTL10

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001019846.1 Gene:ACTL10 / 170487 HGNCID:16127 Length:245 Species:Homo sapiens


Alignment Length:245 Identity:57/245 - (23%)
Similarity:100/245 - (40%) Gaps:33/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 IIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTNQLKELISYRHLNVMDES---HVVNQIKE 215
            :.::.|....|..|...|....|...|:::.|..|:..|::|:...:.:::.::   ..:..:|:
Human    18 LAVEAGAGVCHATPIYAGHSWHQATFRLNVAGSTLSRYLRDLLVAANPDLLQQALPRKAITHLKK 82

  Fly   216 DVCFVAEDFKQAMQVHYSEEKRREVTVDYVLPDFTTVKRGYVRVPGKPREDEEQQQMVSLCNERF 280
            ..|:|:.||:..::    :..|..       |...:|..|.               .|.|.:|||
Human    83 RSCYVSLDFEGDLR----DPARHH-------PASFSVGNGC---------------CVCLSSERF 121

  Fly   281 TVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAHRELLLNILIVGGSAQFPGFLPRLKRDLRAL 345
            ..||.:|.|..:|..:.|:|......|:..|......|...:::.|||..||||..||.::|.|.
Human   122 RCPEPIFQPGLLGQAEQGLPALAFRALQKMPKTLRTRLADTVVLAGGSTLFPGFAERLDKELEAQ 186

  Fly   346 VPDD----LEVSLICPEDPVRYAWYGGKEVATSPNFEEFVYTQDDYEEYG 391
            ....    |...|:.........|.||..||:..:|:....|:..|:|.|
Human   187 CRRHGYAALRPHLVAKHGRGMAVWTGGSMVASLHSFQRRWITRAMYQECG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 57/245 (23%)
COG5277 6..391 CDD:227602 56/243 (23%)
ACTL10NP_001019846.1 NBD_sugar-kinase_HSP70_actin <2..237 CDD:327376 57/245 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.