DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and Acta2

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_031418.1 Gene:Acta2 / 11475 MGIID:87909 Length:377 Species:Mus musculus


Alignment Length:399 Identity:105/399 - (26%)
Similarity:191/399 - (47%) Gaps:47/399 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NAVVVLDNGAHTAKVGLANQDEPHVV-PNCIMKAKSE-------RRRAFVGNQIDECRDTSALYY 59
            :..:|.|||:...|.|.|..|.|..| |:.:.:.:.:       ::.::||::....|....|.|
Mouse     7 STALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKY 71

  Fly    60 ILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVDG 124
              ..:.|.:.||...:.:|.:.|..: :..:.|....::||..:|.::.:|...:|:||.:.|..
Mouse    72 --PIEHGIITNWDDMEKIWHHSFYNE-LRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPA 133

  Fly   125 VYKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALT 189
            :|....|.|:.:     :..|||     .|::|.|...||.||...|..:...|.|:|:.|:.||
Mouse   134 MYVAIQAVLSLY-----ASGRTT-----GIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLT 188

  Fly   190 NQLKELISYRHLNVMD--ESHVVNQIKEDVCFVAEDFKQAMQVHYSEEKRREVTVDYVLPDFTTV 252
            :.|.::::.|..:.:.  |..:|..|||.:|:||.||:..|....|.....:   .|.|||    
Mouse   189 DYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK---SYELPD---- 246

  Fly   253 KRGYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAHRE 317
                             .|::::.||||..||.||.||.||::..||.|...:.:..|..:..::
Mouse   247 -----------------GQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKD 294

  Fly   318 LLLNILIVGGSAQFPGFLPRLKRDLRALVPDDLEVSLICPEDPVRYAWYGGKEVATSPNFEEFVY 382
            |..|.::.||:..:||...|:::::.||.|..:::.:|.|.:.....|.||..:|:...|::...
Mouse   295 LYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 359

  Fly   383 TQDDYEEYG 391
            ::.:|:|.|
Mouse   360 SKQEYDEAG 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 105/399 (26%)
COG5277 6..391 CDD:227602 104/394 (26%)
Acta2NP_031418.1 PTZ00281 3..377 CDD:173506 105/399 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54227
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.