DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and Actg1

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_033739.1 Gene:Actg1 / 11465 MGIID:87906 Length:375 Species:Mus musculus


Alignment Length:398 Identity:105/398 - (26%)
Similarity:191/398 - (47%) Gaps:47/398 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AVVVLDNGAHTAKVGLANQDEPHVV-PNCIMKAKSE-------RRRAFVGNQIDECRDTSALYYI 60
            |.:|:|||:...|.|.|..|.|..| |:.:.:.:.:       ::.::||::....|....|.| 
Mouse     6 AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKY- 69

  Fly    61 LAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVDGV 125
             ..:.|.:.||...:.:|.:.|..: :..:.|...:::||..:|.::.:|...:|:||.:....:
Mouse    70 -PIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM 132

  Fly   126 YKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTN 190
            |....|.|:.:     :..|||     .|::|.|...||.||...|..:...|.|:|:.|:.||:
Mouse   133 YVAIQAVLSLY-----ASGRTT-----GIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTD 187

  Fly   191 QLKELISYR--HLNVMDESHVVNQIKEDVCFVAEDFKQAMQVHYSEEKRREVTVDYVLPDFTTVK 253
            .|.::::.|  ......|..:|..|||.:|:||.||:|.|....|.....:   .|.|||     
Mouse   188 YLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEK---SYELPD----- 244

  Fly   254 RGYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAHREL 318
                            .|::::.||||..||.||.||.:|::..||.|...:.:..|..:..::|
Mouse   245 ----------------GQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDL 293

  Fly   319 LLNILIVGGSAQFPGFLPRLKRDLRALVPDDLEVSLICPEDPVRYAWYGGKEVATSPNFEEFVYT 383
            ..|.::.||:..:||...|:::::.||.|..:::.:|.|.:.....|.||..:|:...|::...:
Mouse   294 YANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 358

  Fly   384 QDDYEEYG 391
            :.:|:|.|
Mouse   359 KQEYDESG 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 105/398 (26%)
COG5277 6..391 CDD:227602 103/394 (26%)
Actg1NP_033739.1 PTZ00281 1..375 CDD:173506 105/398 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54227
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.