DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and ACTR3

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_005712.1 Gene:ACTR3 / 10096 HGNCID:170 Length:418 Species:Homo sapiens


Alignment Length:438 Identity:113/438 - (25%)
Similarity:182/438 - (41%) Gaps:95/438 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLDNGAHTAKVGLANQDEPH-VVPNCIMKAKSER------RRA---------FVGNQIDECRDTS 55
            |:|.|....|:|.|...||. ::|:||...:|.:      ||.         |:|::..| :.|.
Human     9 VVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIE-KPTY 72

  Fly    56 ALYYILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEY 120
            |..:  ..:.|.:.:|...:...:.:..| .:....|:...::|||.:|....:|.|.||:||.:
Human    73 ATKW--PIRHGIVEDWDLMERFMEQVIFK-YLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESF 134

  Fly   121 KVDGVYKTTAADLA-AFNYVA-DSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDM 183
            .|.|:|....|.|| |.::.: ...|||    |...:||.|...|||:|...|..:...|:.|.:
Human   135 NVPGLYIAVQAVLALAASWTSRQVGERT----LTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPI 195

  Fly   184 GGKALTNQLKELISYRHLNVMDES--HVVNQIKEDVCFVAED---------------FKQAMQVH 231
            .|:.:|..:::|:..|.:.:..|.  .....:||...:|..|               .||...::
Human   196 AGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGIN 260

  Fly   232 YSEEKRREVTVDYVLPDFTTVKRGYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQ- 295
            ...:|...:.|.|                                 |||..||:.|:|...... 
Human   261 AISKKEFSIDVGY---------------------------------ERFLGPEIFFHPEFANPDF 292

  Fly   296 QVGIPEAVADCLKACPWEAHRELLLNILIVGGSAQFPGFLPRLKRDLRALV-------------- 346
            ...|.|.|.:.::.||.:..|.|..||::.|||..|..|..||:|||:..|              
Human   293 TQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGR 357

  Fly   347 --PDDLEVSLICPEDPVRYA-WYGGKEVATSPNFEEFVYTQDDYEEYG 391
              |..::|.:| .....||| |:||..:|::|.|.:..:|:.||||.|
Human   358 LKPKPIDVQVI-THHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIG 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 113/438 (26%)
COG5277 6..391 CDD:227602 112/436 (26%)
ACTR3NP_005712.1 PTZ00280 2..417 CDD:240343 113/438 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.