DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp6 and Actl10

DIOPT Version :9

Sequence 1:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_003749645.1 Gene:Actl10 / 100911682 RGDID:6491130 Length:334 Species:Rattus norvegicus


Alignment Length:341 Identity:77/341 - (22%)
Similarity:136/341 - (39%) Gaps:56/341 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 QRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVDGVYKT 128
            :.|.:::|...:.:|:.:. ..|:....|...:::::........:|...|:|||...|...:..
  Rat    28 KHGVVVDWDALEGLWERLM-VGGLQIHPEQWPVLVSDSPSAPPEGREKVAELLFEALTVPACHMA 91

  Fly   129 TAADLA-----AFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKAL 188
            :.|.||     ||:.:|               ::.|....|..|...|....:...|:::.|..|
  Rat    92 STALLALCSVGAFSGLA---------------VEAGAGVCHATPIYAGHSWHKATFRLNVAGSTL 141

  Fly   189 TNQLKELISYR----HLNVMDESHVVNQIKEDVCFVAEDFKQAMQVHYSEEKRREVTVDYVLPDF 249
            :...::|:...    .|:.:... .|.|:|:..|:|:.||    |....:..|.:...      |
  Rat   142 SRYFRDLLVASCPDLQLHALPRK-TVTQLKKRCCYVSLDF----QGDICDPARHQRAC------F 195

  Fly   250 TTVKRGYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEA 314
            ...|..|||                |.:|||..||.:|.||.:|..:.|:|......|:..|...
  Rat   196 CLGKGCYVR----------------LGSERFRCPEPIFQPSLLGHPEPGLPTLAFQALQKIPTTL 244

  Fly   315 HRELLLNILIVGGSAQFPGFLPRLKRDLRALVP----DDLEVSLICPEDPVRYAWYGGKEVATSP 375
            ...|...:::.|||..||||:.|:..:|:|...    ..|:..|:.........|.||..:|:..
  Rat   245 RTRLANTVVLAGGSTLFPGFVERMNLELQAQCRRHGYPALQPCLVAHPGRGTAVWTGGSMMASLH 309

  Fly   376 NFEEFVYTQDDYEEYG 391
            :|:....|:..|:|||
  Rat   310 SFQRRWMTRAMYQEYG 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 77/341 (23%)
COG5277 6..391 CDD:227602 75/339 (22%)
Actl10XP_003749645.1 NBD_sugar-kinase_HSP70_actin 25..329 CDD:302596 77/341 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.