DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MagR and ISA2

DIOPT Version :9

Sequence 1:NP_001259579.1 Gene:MagR / 32513 FlyBaseID:FBgn0026666 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_015392.1 Gene:ISA2 / 856180 SGDID:S000006271 Length:185 Species:Saccharomyces cerevisiae


Alignment Length:140 Identity:35/140 - (25%)
Similarity:60/140 - (42%) Gaps:27/140 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LIPTRAALTLTPAAVLRIKTLLQDKPDMV------GLKVGVRQRGCNGLSY--TLDYASQK---- 71
            ||..:..:..||...|.|.....::...:      .|::.|...||:|..|  ||:.|::.    
Yeast    44 LITPKRIINKTPGLNLSISERASNRLAEIYRNSKENLRISVESGGCHGFQYNLTLEPATKPDIKN 108

  Fly    72 -------ADKLDEE--------VVQDGVKVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKG 121
                   :|.||::        :.:|..:|.||.|:...|..|.:.:....:.|.|...|.::|.
Yeast   109 DVKDKEFSDDLDDDDSKDIIYVLPEDKGRVIIDSKSLNILNNTTLTYTNELIGSSFKIINGSLKS 173

  Fly   122 TCGCGESFSM 131
            :||||.||.:
Yeast   174 SCGCGSSFDI 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagRNP_001259579.1 TIGR00049 27..130 CDD:272875 32/129 (25%)
ISA2NP_015392.1 IscA 58..183 CDD:223393 31/124 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0316
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000696
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.