DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MagR and CPISCA

DIOPT Version :9

Sequence 1:NP_001259579.1 Gene:MagR / 32513 FlyBaseID:FBgn0026666 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_172520.1 Gene:CPISCA / 837590 AraportID:AT1G10500 Length:180 Species:Arabidopsis thaliana


Alignment Length:131 Identity:38/131 - (29%)
Similarity:77/131 - (58%) Gaps:6/131 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATRVVATATVRAVKGRKLIPTRAALTLTPAAVLRIKTLLQDKPDMVGLKVGVRQRGCNGLSYTL 65
            ::.|..:.....|::|.|     .|::|:..|:..:..:..::.:.:.|::||:|.||:|:|||:
plant    52 LSVRSASVPAAPAMEGLK-----PAISLSENALKHLSKMRSERGEDLCLRIGVKQGGCSGMSYTM 111

  Fly    66 DYASQKADKLDEEVVQ-DGVKVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKGTCGCGESF 129
            |:.::...:.|:..:: .|..:..|.|:.|.|.|.::|:.::.:...|.|:|||...|||||:||
plant   112 DFENRANARPDDSTIEYQGFTIVCDPKSMLFLFGMQLDYSDALIGGGFSFSNPNATQTCGCGKSF 176

  Fly   130 S 130
            :
plant   177 A 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagRNP_001259579.1 TIGR00049 27..130 CDD:272875 32/103 (31%)
CPISCANP_172520.1 TIGR00049 74..178 CDD:272875 33/104 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0316
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000696
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101081
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1490
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.670

Return to query results.
Submit another query.